Recombinant Human BTLA Protein, GST-tagged
| Cat.No. : | BTLA-389H |
| Product Overview : | Human BTLA partial ORF ( NP_861445, 190 a.a. - 289 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Protein Length : | 190-289 aa |
| Description : | BTLA expression is induced during activation of T cells, and BTLA remains expressed on Th1 cells but not Th2 cells. Like PD1 (MIM 600244) and CTLA4 (MIM 123890), BTLA interacts with a B7 homolog, B7H4. |
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 36.74 kDa |
| AA Sequence : | DTAGREINLVDAHLKSEQTEASTRQNSQVLLSETGIYDNDPDLCFRMQEGSEVYSNPCLEENKPGIVYASLNHSVIGPNSRLARNVKEAPTEYASICVRS |
| Quality Control Test : | 12.5% SDS-PAGE Stained with Coomassie Blue. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | BTLA B and T lymphocyte associated [ Homo sapiens ] |
| Official Symbol | BTLA |
| Synonyms | BTLA; B and T lymphocyte associated; B- and T-lymphocyte attenuator; BTLA1; CD272; B and T lymphocyte attenuator; B- and T-lymphocyte-associated protein; FLJ16065; MGC129743; |
| Gene ID | 151888 |
| mRNA Refseq | NM_001085357 |
| Protein Refseq | NP_001078826 |
| MIM | 607925 |
| UniProt ID | Q7Z6A9 |
| ◆ Recombinant Proteins | ||
| BTLA-082H | Recombinant Human BTLA Protein (Lys31-Ser150), C-mFc and 6×His-tagged | +Inquiry |
| BTLA-018H | Recombinant Human BTLA protein, DDK/HIS-tagged | +Inquiry |
| BTLA-2925H | Active Recombinant Human BTLA protein, Fc-tagged | +Inquiry |
| BTLA-4665C | Recombinant Cynomolgus monkey BTLA protein, His-Myc-tagged | +Inquiry |
| BTLA-233HAF647 | Recombinant Human BTLA Protein, hFc-tagged, Alexa Fluor 647 conjugated | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| BTLA-732CCL | Recombinant Cynomolgus BTLA cell lysate | +Inquiry |
| BTLA-1278MCL | Recombinant Mouse BTLA cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BTLA Products
Required fields are marked with *
My Review for All BTLA Products
Required fields are marked with *
