"IL7R" Related Products

Expand
Expand
Expand

Recombinant Human Interleukin 7 Receptor, Fc Chimera

Cat. No.: IL7R-129H
Product Overview: Recombinant Human interleukin 7 receptor the signal peptide and extracellular domain of human Interleukin 7 receptor alpha chain (IL-7Ra)(aa 1-236) was expressed in modifiedhuman 293 cells. It was fused to the Fc region of human IgG1 (aa 93-330).
Description: Interleukin 7 (IL-7) is a cytokine that is essential for lymphopoiesis as well as T cell homeostasis and the maintenance of T cell diversity. Additionally, IL-7 promotes T cell cytolytic responses, and acts as co-stimulator for the activation of mature B cells.
Source: Human 293 cells.
Amino Acid Sequence: ESGYAQNGDLE DAELDDYSFS CYSQLEVNGSQ HSLTCAFEDP DVNITNLEFE ICGALV EV KCL NFRKLQ EIY FIETKKF LLIGKSNIC VKVGEKSLTC KKI DLTTI VKPEA PFDLSVVYREGA NDFVVTFNTSH LQKKYVKVLM HDVAYRQEK DE NKWTHVN LSSTKLTLLQRK LQPAA MYE IKVRS IPDHYFKGF WSEWSPSY YFRT PEINNSSG GIPKVDKKVEPKS CDKTHTCPPCPAPE LLGGPSVFLFPPKPK DTLM ISRTPEVT CVVVDVSHEDPEVK FNWYVDGVEVHNA KTKPR E E QY NSTYRVV SVLTV LHQDWLNGKEY KCRVSNKALPAPIEK TISKAKGQPREPQVYT LPP SRDE LTKNQVSLTCL VKGFYPSDIAVEWESNG QPENNYKTTP PVLDSD GSFFLY SKLTV DKSR WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK.
Molecular Mass: IL-7R alpha-Fc Chimera migrates as a broad band between 75 and 90 kDa in SDS-PAGE due to post-translation modifications, in particular glycosylation. This compares with the unmodified IL-7 R alpha-Fc Chimera that has a predicted molecular mass of 50.0kDa.
PI: IL-7 R alpha-Fc Chimera separates into a number of isoforms with a pI between 5.9 and 7.4 in 2D PAGE due to post-translational modifications, in particular glycosylation. This compares with the unmodified IL-7R alpha-Fc Chimera that has a predicted pI of 6.34.
% Carbohydrate: Purified IL-7R alpha-Fc Chimeraconsists of 30-45% carbohydrate by weight.
Glycosylation: IL-7R alpha-Fc Chimera is N-glycosylated and may be O-glycosylated.
Purity: >95%, as determined by SDS-PAGE and visualized by silver stain.
Formulation: When reconstituted in 0.5 ml sterile phosphate-buffered saline, the solution will contain 1% human serum albumin (HSA) and 10% trehalose.
Reconstitution: It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial.
Storage: Lyophilized products should be stored at 2 to 8°C. Following reconstitution short-term storage at 4°C is recommended, and longer-term storage of aliquots at -18 to -20°C. Repeated freeze thawing is not recommended.
Gene Name: IL7R interleukin 7 receptor [ Homo sapiens ]
Synonyms: IL7R; interleukin 7 receptor; CD127; CDW127; IL-7R-alpha; IL7RA;ILRA; CD127 antigen; interleukin 7 receptor alpha chain; interleukin 7 receptor isoform H5-6; CDw127
Gene ID: 3575
mRNA Refseq: NM_002185
Protein Refseq: NP_002176
MIM: 146661
UniProt ID: P16871
Chromosome Location: 5p13
Pathway: Cytokine-cytokine receptor interaction; Jak-STAT signaling pathway; Hematopoietic cell lineage; Primary immunodeficiency
Function: interleukin-7 receptor activity; protein binding; antigen binding; receptor activity

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.