Recombinant Human ABCB1, His-tagged

• Cat.No.: ABCB1-30530TH
• Product Overview: Recombinant fragment, corresponding to amino acids 1036-1280 of Human P Glycoprotein with N terminal His tag; Predicted MWt 28 kDa.

Specification

• Description: The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MDR/TAP subfamily. Members of the MDR/TAP subfamily are involved in multidrug resistance. The protein encoded by this gene is an ATP-dependent drug efflux pump for xenobiotic compounds with broad substrate specificity. It is responsible for decreased drug accumulation in multidrug-resistant cells and often mediates the development of resistance to anticancer drugs. This protein also functions as a transporter in the blood-brain barrier.
• Conjugation: HIS
• Source: E. coli
• Tissue specificity: Expressed in liver, kidney, small intestine and brain.
• Form: Lyophilised:Reconstitute with 37 μl aqua dest.
• Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: TFGEVVFNYPTRPDIPVLQGLSLEVKKGQTLALVGSSGCG KSTVVQLLERFYDPLAGKVLLDGKEIKRLNVQWLRAHL GIVSQEPILFDCSIAENIAYGDNSRVVSQEEIVRAAKE ANIHAFIESLPNKYSTKVGDKGTQLSGGQKQRIAIARA LVRQPHILLLDEATSALDTESEKVVQEALDKAREGRTCIV IAHRLSTIQNADLIVVFQNGRVKEHGTHQQLLAQKGIY FSMVSVQAGTKRQ
• Sequence Similarities: Belongs to the ABC transporter superfamily. ABCB family. Multidrug resistance exporter (TC 3.A.1.201) subfamily.Contains 2 ABC transmembrane type-1 domains.Contains 2 ABC transporter domains.

Gene Information

• Gene Name: ABCB1 ATP-binding cassette, sub-family B (MDR/TAP), member 1 [ Homo sapiens ]
• Official Symbol: ABCB1
• Synonyms: ABCB1; ATP-binding cassette, sub-family B (MDR/TAP), member 1; CLCS, colchicin sensitivity , MDR1, PGY1; multidrug resistance protein 1; ABC20; CD243; GP170; P gp
• Gene ID: 5243
• mRNA Refseq: NM_000927
• Protein Refseq: NP_000918
• MIM: 171050
• Uniprot ID: P08183
• Chromosome Location: 7q21.12
• Pathway: ABC transporters, organism-specific biosystem; ABC transporters, conserved biosystem; ABC-family proteins mediated transport, organism-specific biosystem; Bile secretion, organism-specific biosystem; Bile secretion, conserved biosystem
• Function: ATP binding; ATPase activity; ATPase activity, coupled to transmembrane movement of substances; hydrolase activity; nucleotide binding