"ARHGDIA" Related Products

Expand
Expand
Expand

Recombinant Human ARHGDIA, His-tagged

Cat.No.: ARHGDIA-30981TH
Product Overview: Recombinant fragment, corresponding to amino acids 6-204 of Human RhoGDI with an N terminal His tag; MWt 25kDa.
Description: Aplysia Ras-related homologs (ARHs), also called Rho genes, belong to the RAS gene superfamily encoding small guanine nucleotide exchange (GTP/GDP) factors. The ARH proteins may be kept in the inactive, GDP-bound state by interaction with GDP dissociation inhibitors, such as ARHGDIA (Leffers et al.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:Reconstitute with 156 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: PTAEQLAQIAAENEEDEHSVNYKPPAQKSIQEIQELDKDD ESLRKYKEALLGRVAVSADPNVPNVVVTGLTLVCSSAP GPLELDLTGDLESFKKQSFVLKEGVEYRIKISFRVNRE IVSGMKYIQHTYRKGVKIDKTDYMVGSYGPRAEEYEFL TPVEEAPKGMLARGSYSIKSRFTDDDKTDHLSWEWNLTIK KDWKD
Sequence Similarities: Belongs to the Rho GDI family.
Gene Name: ARHGDIA Rho GDP dissociation inhibitor (GDI) alpha [ Homo sapiens ]
Official Symbol: ARHGDIA
Synonyms: ARHGDIA; Rho GDP dissociation inhibitor (GDI) alpha; GDIA1; rho GDP-dissociation inhibitor 1; RHOGDI;
Gene ID: 396
mRNA Refseq: NM_001185077
Protein Refseq: NP_001172006
MIM: 601925
Uniprot ID: P52565
Chromosome Location: 17q25.3
Pathway: Axonal growth inhibition (RHOA activation), organism-specific biosystem; Axonal growth stimulation, organism-specific biosystem; CDC42 signaling events, organism-specific biosystem; Neurotrophin signaling pathway, organism-specific biosystem; Neurotrophin signaling pathway, conserved biosystem;
Function: GTPase activator activity; Rho GDP-dissociation inhibitor activity;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.