Recombinant Human ARHGDIA, His-tagged
Cat.No. : | ARHGDIA-30981TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 6-204 of Human RhoGDI with an N terminal His tag; MWt 25kDa. |
- Specification
- Gene Information
- Related Products
Description : | Aplysia Ras-related homologs (ARHs), also called Rho genes, belong to the RAS gene superfamily encoding small guanine nucleotide exchange (GTP/GDP) factors. The ARH proteins may be kept in the inactive, GDP-bound state by interaction with GDP dissociation inhibitors, such as ARHGDIA (Leffers et al. |
Conjugation : | HIS |
Source : | E. coli |
Form : | Lyophilised:Reconstitute with 156 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | PTAEQLAQIAAENEEDEHSVNYKPPAQKSIQEIQELDKDD ESLRKYKEALLGRVAVSADPNVPNVVVTGLTLVCSSAP GPLELDLTGDLESFKKQSFVLKEGVEYRIKISFRVNRE IVSGMKYIQHTYRKGVKIDKTDYMVGSYGPRAEEYEFL TPVEEAPKGMLARGSYSIKSRFTDDDKTDHLSWEWNLTIK KDWKD |
Sequence Similarities : | Belongs to the Rho GDI family. |
Gene Name : | ARHGDIA Rho GDP dissociation inhibitor (GDI) alpha [ Homo sapiens ] |
Official Symbol : | ARHGDIA |
Synonyms : | ARHGDIA; Rho GDP dissociation inhibitor (GDI) alpha; GDIA1; rho GDP-dissociation inhibitor 1; RHOGDI; |
Gene ID : | 396 |
mRNA Refseq : | NM_001185077 |
Protein Refseq : | NP_001172006 |
MIM : | 601925 |
Uniprot ID : | P52565 |
Chromosome Location : | 17q25.3 |
Pathway : | Axonal growth inhibition (RHOA activation), organism-specific biosystem; Axonal growth stimulation, organism-specific biosystem; CDC42 signaling events, organism-specific biosystem; Neurotrophin signaling pathway, organism-specific biosystem; Neurotrophin signaling pathway, conserved biosystem; |
Function : | GTPase activator activity; Rho GDP-dissociation inhibitor activity; |
Products Types
◆ Recombinant Protein | ||
Arhgdia-1689M | Recombinant Mouse Arhgdia Protein, Myc/DDK-tagged | +Inquiry |
ARHGDIA-688M | Recombinant Mouse ARHGDIA Protein, His (Fc)-Avi-tagged | +Inquiry |
ARHGDIA-60C | Recombinant Cynomolgus Monkey ARHGDIA Protein, His (Fc)-Avi-tagged | +Inquiry |
ARHGDIA-424R | Recombinant Rat ARHGDIA Protein, His (Fc)-Avi-tagged | +Inquiry |
ARHGDIA-1883M | Recombinant Mouse ARHGDIA Protein | +Inquiry |
◆ Lysates | ||
ARHGDIA-8736HCL | Recombinant Human ARHGDIA 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket