"ARHGDIA" Related Products

Expand
Expand
Expand

Recombinant Human ARHGDIA, His-tagged

Cat.No.: ARHGDIA-30981TH
Product Overview: Recombinant fragment, corresponding to amino acids 6-204 of Human RhoGDI with an N terminal His tag; MWt 25kDa.
Description: Aplysia Ras-related homologs (ARHs), also called Rho genes, belong to the RAS gene superfamily encoding small guanine nucleotide exchange (GTP/GDP) factors. The ARH proteins may be kept in the inactive, GDP-bound state by interaction with GDP dissociation inhibitors, such as ARHGDIA (Leffers et al.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:Reconstitute with 156 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: PTAEQLAQIAAENEEDEHSVNYKPPAQKSIQEIQELDKDD ESLRKYKEALLGRVAVSADPNVPNVVVTGLTLVCSSAP GPLELDLTGDLESFKKQSFVLKEGVEYRIKISFRVNRE IVSGMKYIQHTYRKGVKIDKTDYMVGSYGPRAEEYEFL TPVEEAPKGMLARGSYSIKSRFTDDDKTDHLSWEWNLTIK KDWKD
Sequence Similarities: Belongs to the Rho GDI family.
Gene Name: ARHGDIA Rho GDP dissociation inhibitor (GDI) alpha [ Homo sapiens ]
Official Symbol: ARHGDIA
Synonyms: ARHGDIA; Rho GDP dissociation inhibitor (GDI) alpha; GDIA1; rho GDP-dissociation inhibitor 1; RHOGDI;
Gene ID: 396
mRNA Refseq: NM_001185077
Protein Refseq: NP_001172006
MIM: 601925
Uniprot ID: P52565
Chromosome Location: 17q25.3
Pathway: Axonal growth inhibition (RHOA activation), organism-specific biosystem; Axonal growth stimulation, organism-specific biosystem; CDC42 signaling events, organism-specific biosystem; Neurotrophin signaling pathway, organism-specific biosystem; Neurotrophin signaling pathway, conserved biosystem;
Function: GTPase activator activity; Rho GDP-dissociation inhibitor activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.