Recombinant Human ARHGEF1, His-tagged

Cat.No. : ARHGEF1-27183TH
Product Overview : Recombinant fragment, corresponding to amino acids 491-655 of Human ARHGEF1 isoform 2 with a N terminal His tag; predicted MWt 20 kDa:
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 491-655 a.a.
Description : Rho GTPases play a fundamental role in numerous cellular processes that are initiated by extracellular stimuli that work through G protein coupled receptors. The encoded protein may form complex with G proteins and stimulate Rho-dependent signals. Multiple alternatively spliced transcript variants have been found for this gene, but the full-length nature of some variants has not been defined.
Conjugation : HIS
Form : Lyophilised:Reconstitution with 129 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : EQLKAKQRKDPRFCAFVQEAESRPRCRRLQLKDMIPTEMQ RLTKYPLLLQSIGQNTEEPTEREKVELAAECCREILHH VNQAVRDMEDLLRLKDYQRRLDLSHLRQSSDPMLSEFK NLDITKKKLVHEGPLTWRVTKDKAVEVHVLLLDDLLLLLQ RQDERLLLK
Gene Name ARHGEF1 Rho guanine nucleotide exchange factor (GEF) 1 [ Homo sapiens ]
Official Symbol ARHGEF1
Synonyms ARHGEF1; Rho guanine nucleotide exchange factor (GEF) 1; rho guanine nucleotide exchange factor 1; LBCL2; P115 RHOGEF; SUB1.5;
Gene ID 9138
mRNA Refseq NM_004706
Protein Refseq NP_004697
MIM 601855
Uniprot ID Q92888
Chromosome Location 19q13.13
Pathway Axonal growth inhibition (RHOA activation), organism-specific biosystem; Axonal growth stimulation, organism-specific biosystem; G Protein Signaling Pathways, organism-specific biosystem; G alpha (12/13) signalling events, organism-specific biosystem; G13 Signaling Pathway, organism-specific biosystem;
Function GTPase activator activity; Rho guanyl-nucleotide exchange factor activity; guanyl-nucleotide exchange factor activity; protein binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ARHGEF1 Products

Required fields are marked with *

My Review for All ARHGEF1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon