"ARHGEF1" Related Products

Expand

Recombinant Human ARHGEF1, His-tagged

Cat.No. : ARHGEF1-27183TH
Product Overview : Recombinant fragment, corresponding to amino acids 491-655 of Human ARHGEF1 isoform 2 with a N terminal His tag; predicted MWt 20 kDa:
Description : Rho GTPases play a fundamental role in numerous cellular processes that are initiated by extracellular stimuli that work through G protein coupled receptors. The encoded protein may form complex with G proteins and stimulate Rho-dependent signals. Multiple alternatively spliced transcript variants have been found for this gene, but the full-length nature of some variants has not been defined.
Conjugation : HIS
Source : E. coli
Form : Lyophilised:Reconstitution with 129 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : EQLKAKQRKDPRFCAFVQEAESRPRCRRLQLKDMIPTEMQ RLTKYPLLLQSIGQNTEEPTEREKVELAAECCREILHH VNQAVRDMEDLLRLKDYQRRLDLSHLRQSSDPMLSEFK NLDITKKKLVHEGPLTWRVTKDKAVEVHVLLLDDLLLLLQ RQDERLLLK
Gene Name : ARHGEF1 Rho guanine nucleotide exchange factor (GEF) 1 [ Homo sapiens ]
Official Symbol : ARHGEF1
Synonyms : ARHGEF1; Rho guanine nucleotide exchange factor (GEF) 1; rho guanine nucleotide exchange factor 1; LBCL2; P115 RHOGEF; SUB1.5;
Gene ID : 9138
mRNA Refseq : NM_004706
Protein Refseq : NP_004697
MIM : 601855
Uniprot ID : Q92888
Chromosome Location : 19q13.13
Pathway : Axonal growth inhibition (RHOA activation), organism-specific biosystem; Axonal growth stimulation, organism-specific biosystem; G Protein Signaling Pathways, organism-specific biosystem; G alpha (12/13) signalling events, organism-specific biosystem; G13 Signaling Pathway, organism-specific biosystem;
Function : GTPase activator activity; Rho guanyl-nucleotide exchange factor activity; guanyl-nucleotide exchange factor activity; protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.