"ARHGEF1" Related Products

Expand

Recombinant Human ARHGEF1, His-tagged

Cat.No.: ARHGEF1-27183TH
Product Overview: Recombinant fragment, corresponding to amino acids 491-655 of Human ARHGEF1 isoform 2 with a N terminal His tag; predicted MWt 20 kDa:
Description: Rho GTPases play a fundamental role in numerous cellular processes that are initiated by extracellular stimuli that work through G protein coupled receptors. The encoded protein may form complex with G proteins and stimulate Rho-dependent signals. Multiple alternatively spliced transcript variants have been found for this gene, but the full-length nature of some variants has not been defined.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:Reconstitution with 129 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: EQLKAKQRKDPRFCAFVQEAESRPRCRRLQLKDMIPTEMQ RLTKYPLLLQSIGQNTEEPTEREKVELAAECCREILHH VNQAVRDMEDLLRLKDYQRRLDLSHLRQSSDPMLSEFK NLDITKKKLVHEGPLTWRVTKDKAVEVHVLLLDDLLLLLQ RQDERLLLK
Gene Name: ARHGEF1 Rho guanine nucleotide exchange factor (GEF) 1 [ Homo sapiens ]
Official Symbol: ARHGEF1
Synonyms: ARHGEF1; Rho guanine nucleotide exchange factor (GEF) 1; rho guanine nucleotide exchange factor 1; LBCL2; P115 RHOGEF; SUB1.5;
Gene ID: 9138
mRNA Refseq: NM_004706
Protein Refseq: NP_004697
MIM: 601855
Uniprot ID: Q92888
Chromosome Location: 19q13.13
Pathway: Axonal growth inhibition (RHOA activation), organism-specific biosystem; Axonal growth stimulation, organism-specific biosystem; G Protein Signaling Pathways, organism-specific biosystem; G alpha (12/13) signalling events, organism-specific biosystem; G13 Signaling Pathway, organism-specific biosystem;
Function: GTPase activator activity; Rho guanyl-nucleotide exchange factor activity; guanyl-nucleotide exchange factor activity; protein binding;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.