Recombinant Human ARHGEF1, His-tagged

• Cat.No.: ARHGEF1-27183TH
• Product Overview: Recombinant fragment, corresponding to amino acids 491-655 of Human ARHGEF1 isoform 2 with a N terminal His tag; predicted MWt 20 kDa:

Specification

• Description: Rho GTPases play a fundamental role in numerous cellular processes that are initiated by extracellular stimuli that work through G protein coupled receptors. The encoded protein may form complex with G proteins and stimulate Rho-dependent signals. Multiple alternatively spliced transcript variants have been found for this gene, but the full-length nature of some variants has not been defined.
• Conjugation: HIS
• Source: E. coli
• Form: Lyophilised:Reconstitution with 129 μl aqua dest.
• Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: EQLKAKQRKDPRFCAFVQEAESRPRCRRLQLKDMIPTEMQ RLTKYPLLLQSIGQNTEEPTEREKVELAAECCREILHH VNQAVRDMEDLLRLKDYQRRLDLSHLRQSSDPMLSEFK NLDITKKKLVHEGPLTWRVTKDKAVEVHVLLLDDLLLLLQ RQDERLLLK

Gene Information

• Gene Name: ARHGEF1 Rho guanine nucleotide exchange factor (GEF) 1 [ Homo sapiens ]
• Official Symbol: ARHGEF1
• Synonyms: ARHGEF1; Rho guanine nucleotide exchange factor (GEF) 1; rho guanine nucleotide exchange factor 1; LBCL2; P115 RHOGEF; SUB1.5
• Gene ID: 9138
• mRNA Refseq: NM_004706
• Protein Refseq: NP_004697
• MIM: 601855
• Uniprot ID: Q92888
• Chromosome Location: 19q13.13
• Pathway: Axonal growth inhibition (RHOA activation), organism-specific biosystem; Axonal growth stimulation, organism-specific biosystem; G Protein Signaling Pathways, organism-specific biosystem; G alpha (12/13) signalling events, organism-specific biosystem; G13 Signaling Pathway, organism-specific biosystem
• Function: GTPase activator activity; Rho guanyl-nucleotide exchange factor activity; guanyl-nucleotide exchange factor activity; protein binding