Recombinant Human ARHGEF1, His-tagged
Cat.No. : | ARHGEF1-27183TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 491-655 of Human ARHGEF1 isoform 2 with a N terminal His tag; predicted MWt 20 kDa: |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 491-655 a.a. |
Description : | Rho GTPases play a fundamental role in numerous cellular processes that are initiated by extracellular stimuli that work through G protein coupled receptors. The encoded protein may form complex with G proteins and stimulate Rho-dependent signals. Multiple alternatively spliced transcript variants have been found for this gene, but the full-length nature of some variants has not been defined. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitution with 129 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | EQLKAKQRKDPRFCAFVQEAESRPRCRRLQLKDMIPTEMQ RLTKYPLLLQSIGQNTEEPTEREKVELAAECCREILHH VNQAVRDMEDLLRLKDYQRRLDLSHLRQSSDPMLSEFK NLDITKKKLVHEGPLTWRVTKDKAVEVHVLLLDDLLLLLQ RQDERLLLK |
Gene Name | ARHGEF1 Rho guanine nucleotide exchange factor (GEF) 1 [ Homo sapiens ] |
Official Symbol | ARHGEF1 |
Synonyms | ARHGEF1; Rho guanine nucleotide exchange factor (GEF) 1; rho guanine nucleotide exchange factor 1; LBCL2; P115 RHOGEF; SUB1.5; |
Gene ID | 9138 |
mRNA Refseq | NM_004706 |
Protein Refseq | NP_004697 |
MIM | 601855 |
Uniprot ID | Q92888 |
Chromosome Location | 19q13.13 |
Pathway | Axonal growth inhibition (RHOA activation), organism-specific biosystem; Axonal growth stimulation, organism-specific biosystem; G Protein Signaling Pathways, organism-specific biosystem; G alpha (12/13) signalling events, organism-specific biosystem; G13 Signaling Pathway, organism-specific biosystem; |
Function | GTPase activator activity; Rho guanyl-nucleotide exchange factor activity; guanyl-nucleotide exchange factor activity; protein binding; |
◆ Recombinant Proteins | ||
ARHGEF1-1886M | Recombinant Mouse ARHGEF1 Protein | +Inquiry |
ARHGEF1-27183TH | Recombinant Human ARHGEF1, His-tagged | +Inquiry |
ARHGEF1-2699H | Recombinant Human ARHGEF1 Protein, MYC/DDK-tagged | +Inquiry |
Arhgef1-1298M | Recombinant Mouse Arhgef1 Protein, MYC/DDK-tagged | +Inquiry |
ARHGEF1-690M | Recombinant Mouse ARHGEF1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ARHGEF1 Products
Required fields are marked with *
My Review for All ARHGEF1 Products
Required fields are marked with *
0
Inquiry Basket