Recombinant Human ASGR2
Cat.No. : | ASGR2-26516TH |
Product Overview : | Recombinant full length Human Asialoglycoprotein Receptor 2, isoform 3 , with an N terminal proprietary tag; predicted MW 57.31 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 287 amino acids |
Description : | This gene encodes a subunit of the asialoglycoprotein receptor. This receptor is a transmembrane protein that plays a critical role in serum glycoprotein homeostasis by mediating the endocytosis and lysosomal degradation of glycoproteins with exposed terminal galactose or N-acetylgalactosamine residues. The asialoglycoprotein receptor may facilitate hepatic infection by multiple viruses including hepatitis B, and is also a target for liver-specific drug delivery. The asialoglycoprotein receptor is a hetero-oligomeric protein composed of major and minor subunits, which are encoded by different genes. The protein encoded by this gene is the less abundant minor subunit. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. |
Molecular Weight : | 57.310kDa inclusive of tags |
Tissue specificity : | Expressed exclusively in hepatic parenchymal cells. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MAKDFQDIQQLSSEENDHPFHQGPPPAQPLAQRLCSMVCF SLLALSFNILLLVVICVTGSQSAQLQAELRSLKEAFSNFS SSTLTEVQAISTHGGSVGDKITSLGAKLEKQQQDLKADHD ALLFHLKHFPVDLRFVACQMELLHSNGSQRTCCPVNWVEH QGSCYWFSHSGKAWAEAEKYCQLENAHLVVINSWEEQRFI VQHTNPFNTWIGLTDSDGSWKWVDGTDYRHNYKNWAVTQP DNWRGHELGGSEDCVEVQPDGRWNDDFCLQVYRWVCEKRR NATGEVA |
Sequence Similarities : | Contains 1 C-type lectin domain. |
Gene Name | ASGR2 asialoglycoprotein receptor 2 [ Homo sapiens ] |
Official Symbol | ASGR2 |
Synonyms | ASGR2; asialoglycoprotein receptor 2; CLEC4H2; |
Gene ID | 433 |
mRNA Refseq | NM_001181 |
Protein Refseq | NP_001172 |
MIM | 108361 |
Uniprot ID | P07307 |
Chromosome Location | 17p |
Function | asialoglycoprotein receptor activity; protein binding; receptor activity; sugar binding; |
◆ Recombinant Proteins | ||
Asgr2-562R | Recombinant Rat Asgr2 Full Length Transmembrane protein, His-tagged | +Inquiry |
RFL-19265HF | Recombinant Full Length Human Asialoglycoprotein Receptor 2(Asgr2) Protein, His-Tagged | +Inquiry |
ASGR2-2815H | Recombinant Human ASGR2 Protein, MYC/DDK-tagged | +Inquiry |
ASGR2-208H | Recombinant Human asialoglycoprotein receptor 2 Protein, Tag Free | +Inquiry |
Asgr2-3665M | Active Recombinant Mouse Asgr2 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ASGR2-1492HCL | Recombinant Human ASGR2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ASGR2 Products
Required fields are marked with *
My Review for All ASGR2 Products
Required fields are marked with *
0
Inquiry Basket