"ASGR2" Related Products

Expand

Recombinant Human ASGR2

Cat.No.: ASGR2-26516TH
Product Overview: Recombinant full length Human Asialoglycoprotein Receptor 2, isoform 3 , with an N terminal proprietary tag; predicted MW 57.31 kDa.
Description: This gene encodes a subunit of the asialoglycoprotein receptor. This receptor is a transmembrane protein that plays a critical role in serum glycoprotein homeostasis by mediating the endocytosis and lysosomal degradation of glycoproteins with exposed terminal galactose or N-acetylgalactosamine residues. The asialoglycoprotein receptor may facilitate hepatic infection by multiple viruses including hepatitis B, and is also a target for liver-specific drug delivery. The asialoglycoprotein receptor is a hetero-oligomeric protein composed of major and minor subunits, which are encoded by different genes. The protein encoded by this gene is the less abundant minor subunit. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
Protein length: 287 amino acids
Molecular Weight: 57.310kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Expressed exclusively in hepatic parenchymal cells.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MAKDFQDIQQLSSEENDHPFHQGPPPAQPLAQRLCSMVCF SLLALSFNILLLVVICVTGSQSAQLQAELRSLKEAFSNFS SSTLTEVQAISTHGGSVGDKITSLGAKLEKQQQDLKADHD ALLFHLKHFPVDLRFVACQMELLHSNGSQRTCCPVNWVEH QGSCYWFSHSGKAWAEAEKYCQLENAHLVVINSWEEQRFI VQHTNPFNTWIGLTDSDGSWKWVDGTDYRHNYKNWAVTQP DNWRGHELGGSEDCVEVQPDGRWNDDFCLQVYRWVCEKRR NATGEVA
Sequence Similarities: Contains 1 C-type lectin domain.
Gene Name: ASGR2 asialoglycoprotein receptor 2 [ Homo sapiens ]
Official Symbol: ASGR2
Synonyms: ASGR2; asialoglycoprotein receptor 2; CLEC4H2;
Gene ID: 433
mRNA Refseq: NM_001181
Protein Refseq: NP_001172
MIM: 108361
Uniprot ID: P07307
Chromosome Location: 17p
Function: asialoglycoprotein receptor activity; protein binding; receptor activity; sugar binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.