Recombinant Human ATIC ATIC-27034TH

Recombinant Human ATIC

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human ATIC

Recombinant Human ATIC

ATIC Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : ATIC-27034TH
Product Overview : Recombinant full length Human ATIC with N terminal proprietary tag; Predicted MW 91.19kDa.
Description : This gene encodes a bifunctional protein that catalyzes the last two steps of the de novo purine biosynthetic pathway. The N-terminal domain has phosphoribosylaminoimidazolecarboxamide formyltransferase activity, and the C-terminal domain has IMP cyclohydrolase activity. A mutation in this gene results in AICA-ribosiduria.
Protein length : 592 amino acids
Molecular Weight : 91.190kDa inclusive of tags
Source : Wheat germ
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MAPGQLALFSVSDKTGLVEFARNLTALGLNLVASGGTAKA LRDAGLAVRDVSELTGFPEMLGGRVKTLHPAVHAGILA RNIPEDNADMARLDFNLIRVVACNLYPFVKTVASPGVTVE EAVEQIDIGGVTLLRAAAKNHARVTVVCEPEDYVVVST EMQSSESKDTSLETRRQLALKAFTHTAQYDEAISDYFR KQYSKGVSQMPLRYGMNPHQTPAQLYTLQPKLPITVLNGA PGFINLCDALNAWQLVKELKEALGIPAAASFKHVSPAG AAVGIPLSEDEAKVCMVYDLYKTLTPISAAYARARGAD RMSSFGDFVALSDVCDVPTAKIISREVSDGIIAPGYEEEA LTILSKKKNGNYCVLQMDQSYKPDENEVRTLFGLHLSQ KRNNGVVDKSLFSNVVTKNKDLPESALRDLIVATIAVK YTQSNSVCYAKNGQVIGIGAGQQSRIHCTRLAGDKANYWW LRHHPQVLSMKFKTGVKRAEISNAIDQYVTGTIGEDED LIKWKALFEEVPELLTEAEKKEWVEKLTEVSISSDAFF PFRDNVDRAKRSGVAYIAAPSGSAADKVVIEACDELGIIL AHTNLRLFHH
Sequence Similarities : Belongs to the purH family.
Gene Name : ATIC 5-aminoimidazole-4-carboxamide ribonucleotide formyltransferase/IMP cyclohydrolase [ Homo sapiens ]
Official Symbol : ATIC
Synonyms : ATIC; 5-aminoimidazole-4-carboxamide ribonucleotide formyltransferase/IMP cyclohydrolase; bifunctional purine biosynthesis protein PURH; AICARFT; IMPCHASE; phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase; PURH;
Gene ID : 471
mRNA Refseq : NM_004044
Protein Refseq : NP_004035
MIM : 601731
Uniprot ID : P31939
Chromosome Location : 2q35
Pathway : Inosine monophosphate biosynthesis, PRPP + glutamine => IMP, organism-specific biosystem; Inosine monophosphate biosynthesis, PRPP + glutamine => IMP, conserved biosystem; Metabolic pathways, organism-specific biosystem;
Function : IMP cyclohydrolase activity; hydrolase activity; phosphoribosylaminoimidazolecarboxamide formyltransferase activity; protein homodimerization activity; transferase activity;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy