Recombinant Human ATIC
| Cat.No. : | ATIC-27034TH |
| Product Overview : | Recombinant full length Human ATIC with N terminal proprietary tag; Predicted MW 91.19kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 592 amino acids |
| Description : | This gene encodes a bifunctional protein that catalyzes the last two steps of the de novo purine biosynthetic pathway. The N-terminal domain has phosphoribosylaminoimidazolecarboxamide formyltransferase activity, and the C-terminal domain has IMP cyclohydrolase activity. A mutation in this gene results in AICA-ribosiduria. |
| Molecular Weight : | 91.190kDa inclusive of tags |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | MAPGQLALFSVSDKTGLVEFARNLTALGLNLVASGGTAKA LRDAGLAVRDVSELTGFPEMLGGRVKTLHPAVHAGILA RNIPEDNADMARLDFNLIRVVACNLYPFVKTVASPGVTVE EAVEQIDIGGVTLLRAAAKNHARVTVVCEPEDYVVVST EMQSSESKDTSLETRRQLALKAFTHTAQYDEAISDYFR KQYSKGVSQMPLRYGMNPHQTPAQLYTLQPKLPITVLNGA PGFINLCDALNAWQLVKELKEALGIPAAASFKHVSPAG AAVGIPLSEDEAKVCMVYDLYKTLTPISAAYARARGAD RMSSFGDFVALSDVCDVPTAKIISREVSDGIIAPGYEEEA LTILSKKKNGNYCVLQMDQSYKPDENEVRTLFGLHLSQ KRNNGVVDKSLFSNVVTKNKDLPESALRDLIVATIAVK YTQSNSVCYAKNGQVIGIGAGQQSRIHCTRLAGDKANYWW LRHHPQVLSMKFKTGVKRAEISNAIDQYVTGTIGEDED LIKWKALFEEVPELLTEAEKKEWVEKLTEVSISSDAFF PFRDNVDRAKRSGVAYIAAPSGSAADKVVIEACDELGIIL AHTNLRLFHH |
| Sequence Similarities : | Belongs to the purH family. |
| Gene Name | ATIC 5-aminoimidazole-4-carboxamide ribonucleotide formyltransferase/IMP cyclohydrolase [ Homo sapiens ] |
| Official Symbol | ATIC |
| Synonyms | ATIC; 5-aminoimidazole-4-carboxamide ribonucleotide formyltransferase/IMP cyclohydrolase; bifunctional purine biosynthesis protein PURH; AICARFT; IMPCHASE; phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase; PURH; |
| Gene ID | 471 |
| mRNA Refseq | NM_004044 |
| Protein Refseq | NP_004035 |
| MIM | 601731 |
| Uniprot ID | P31939 |
| Chromosome Location | 2q35 |
| Pathway | Inosine monophosphate biosynthesis, PRPP + glutamine => IMP, organism-specific biosystem; Inosine monophosphate biosynthesis, PRPP + glutamine => IMP, conserved biosystem; Metabolic pathways, organism-specific biosystem; |
| Function | IMP cyclohydrolase activity; hydrolase activity; phosphoribosylaminoimidazolecarboxamide formyltransferase activity; protein homodimerization activity; transferase activity; |
| ◆ Recombinant Proteins | ||
| ATIC-31HF | Recombinant Full Length Human ATIC Protein | +Inquiry |
| ATIC-6733C | Recombinant Chicken ATIC | +Inquiry |
| ATIC-24H | Recombinant Human ATIC protein, His-tagged | +Inquiry |
| ATIC-1075HF | Recombinant Full Length Human ATIC Protein, GST-tagged | +Inquiry |
| ATIC-4383H | Recombinant Human ATIC Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ATIC-8618HCL | Recombinant Human ATIC 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ATIC Products
Required fields are marked with *
My Review for All ATIC Products
Required fields are marked with *
