Recombinant Human ATIC protein, GST-tagged
Cat.No. : | ATIC-25H |
Product Overview : | Recombinant Human ATIC protein(NP_004035.2)(291-592 aa) was fused to GST-tagged and expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 291-592 aa |
Description : | This gene encodes a bifunctional protein that catalyzes the last two steps of the de novo purine biosynthetic pathway. The N-terminal domain has phosphoribosylaminoimidazolecarboxamide formyltransferase activity, and the C-terminal domain has IMP cyclohydrolase activity. A mutation in this gene results in AICA-ribosiduria. |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4), 5 % trehalose and 5 % mannitol are added as protectants before lyophilization. |
Bio-activity : | Not tested. |
AA Sequence : | DLYKTLTPISAAYARARGADRMSSFGDFVALSDVCDVPTAKIISREVSDGIIAPGYEEEALTILSKKKNGNYCVLQMDQSYKPDENEVRTLFGLHLSQKRNNGVVDKSLFSNVVTKNKDLPESALRDLIVATIAVKYTQSNSVCYAKNGQVIGIGAGQQSRIHCTRLAGDKANYWWLRHHPQVLSMKFKTGVKRAEISNAIDQYVTGTIGEDEDLIKWKALFEEVPELLTEAEKKEWVEKLTEVSISSDAFFPFRDNVDRAKRSGVAYIAAPSGSAADKVVIEACDELGIILAHTNLRLFHH |
Endotoxin : | <1.0 EU per μg protein as determined by the LAL method. |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Applications : | Blocking peptide |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details). If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used). Note: Centrifuge vial before opening. When reconstituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution. |
Shipping : | The product is shipped at ambient temperature. Upon receipt, store it immediately at the recommended temperature(see below). |
Gene Name | ATIC |
Official Symbol | ATIC |
Synonyms | AICAR; AICARFT; FLJ93545; IMPCHASE; PURH |
Gene ID | 471 |
mRNA Refseq | NM_004044.7 |
Protein Refseq | NP_004035.2 |
MIM | 601731 |
UniProt ID | P31939 |
◆ Recombinant Proteins | ||
ATIC-503R | Recombinant Rat ATIC Protein, His (Fc)-Avi-tagged | +Inquiry |
ATIC-4383H | Recombinant Human ATIC Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ATIC-27034TH | Recombinant Human ATIC | +Inquiry |
ATIC-25H | Recombinant Human ATIC protein, GST-tagged | +Inquiry |
ATIC-831M | Recombinant Mouse ATIC Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ATIC-8618HCL | Recombinant Human ATIC 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ATIC Products
Required fields are marked with *
My Review for All ATIC Products
Required fields are marked with *
0
Inquiry Basket