Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at AACR Annual Meeting|Apr. 5-10, 2024|Booth #2953

Recombinant Human ATOX1

Cat.No. : ATOX1-26679TH
Product Overview : Recombinant Full Length Human ATOX1 produced in Saccharomyces cerevisiae; amino acids 1-68 with 26 kDa tag. Molecular weight with tag is 34 kDa.
  • Specification
  • Gene Information
  • Related Products
Description : This gene encodes a copper chaperone that plays a role in copper homeostasis by binding and transporting cytosolic copper to ATPase proteins in the trans-Golgi network for later incorporation to the ceruloplasmin. This protein also functions as an antioxidant against superoxide and hydrogen peroxide, and therefore, may play a significant role in cancer carcinogenesis. Because of its cytogenetic location, this gene represents a candidate gene for 5q-syndrome.
Tissue specificity : Ubiquitous.
Form : Liquid
Purity : >90% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
Sequences of amino acids : MPKHEFSVDMTCGGCAEAVSRVLNKLGGVKYDIDLPNKKV CIESEHSMDTLLATLKKTGKTVSYLGLE
Sequence Similarities : Belongs to the ATX1 family.Contains 1 HMA domain.
Gene Name : ATOX1 ATX1 antioxidant protein 1 homolog (yeast) [ Homo sapiens ]
Official Symbol : ATOX1
Synonyms : ATOX1; ATX1 antioxidant protein 1 homolog (yeast); ATX1 (antioxidant protein 1, yeast) homolog 1; copper transport protein ATOX1; HAH1;
Gene ID : 475
mRNA Refseq : NM_004045
Protein Refseq : NP_004036
MIM : 602270
Uniprot ID : O00244
Chromosome Location : 5q32
Pathway : Mineral absorption, organism-specific biosystem; Mineral absorption, conserved biosystem;
Function : copper chaperone activity; copper ion binding; copper-dependent protein binding; metal ion binding; metallochaperone activity;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (0)

Ask a question

Customer Reviews (0)

Write a review

Ask a Question for All ATOX1 Products

Required fields are marked with *

My Review for All ATOX1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends