Recombinant Human ATOX1
Cat.No. : | ATOX1-26679TH |
Product Overview : | Recombinant Full Length Human ATOX1 produced in Saccharomyces cerevisiae; amino acids 1-68 with 26 kDa tag. Molecular weight with tag is 34 kDa. |
- Specification
- Gene Information
- Related Products
Description : | This gene encodes a copper chaperone that plays a role in copper homeostasis by binding and transporting cytosolic copper to ATPase proteins in the trans-Golgi network for later incorporation to the ceruloplasmin. This protein also functions as an antioxidant against superoxide and hydrogen peroxide, and therefore, may play a significant role in cancer carcinogenesis. Because of its cytogenetic location, this gene represents a candidate gene for 5q-syndrome. |
Tissue specificity : | Ubiquitous. |
Form : | Liquid |
Purity : | >90% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MPKHEFSVDMTCGGCAEAVSRVLNKLGGVKYDIDLPNKKV CIESEHSMDTLLATLKKTGKTVSYLGLE |
Sequence Similarities : | Belongs to the ATX1 family.Contains 1 HMA domain. |
Gene Name : | ATOX1 ATX1 antioxidant protein 1 homolog (yeast) [ Homo sapiens ] |
Official Symbol : | ATOX1 |
Synonyms : | ATOX1; ATX1 antioxidant protein 1 homolog (yeast); ATX1 (antioxidant protein 1, yeast) homolog 1; copper transport protein ATOX1; HAH1; |
Gene ID : | 475 |
mRNA Refseq : | NM_004045 |
Protein Refseq : | NP_004036 |
MIM : | 602270 |
Uniprot ID : | O00244 |
Chromosome Location : | 5q32 |
Pathway : | Mineral absorption, organism-specific biosystem; Mineral absorption, conserved biosystem; |
Function : | copper chaperone activity; copper ion binding; copper-dependent protein binding; metal ion binding; metallochaperone activity; |
Products Types
◆ Recombinant Protein | ||
ATOX1-840M | Recombinant Mouse ATOX1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ATOX1-506R | Recombinant Rat ATOX1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ATOX1-6909H | Recombinant Human ATX1 Antioxidant Protein 1 Homolog (yeast), His-tagged | +Inquiry |
ATOX1-5084C | Recombinant Chicken ATOX1 | +Inquiry |
ATOX1-8172Z | Recombinant Zebrafish ATOX1 | +Inquiry |
◆ Lysates | ||
ATOX1-8616HCL | Recombinant Human ATOX1 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (0)
Ask a questionAsk a Question for All ATOX1 Products
Required fields are marked with *
My Review for All ATOX1 Products
Required fields are marked with *
0
Inquiry Basket