"ATP5B" Related Products

Expand

Recombinant Human ATP5B, His-tagged

Cat.No.: ATP5B-26425TH
Product Overview: Recombinant fragment, corresponding to amino acids 156-529 of Human ATPB, with N terminal His tag, 374 amino acids, MWt 45kDa, ,
Description: This gene encodes a subunit of mitochondrial ATP synthase. Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. ATP synthase is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, comprising the proton channel. The catalytic portion of mitochondrial ATP synthase consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled with a stoichiometry of 3 alpha, 3 beta, and a single representative of the other 3. The proton channel consists of three main subunits (a, b, c). This gene encodes the beta subunit of the catalytic core.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:Reconstitution with 143 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: GPIKTKQFAPIHAEAPEFMEMSVEQEILVTGIKVVDLLAP YAKGGKIGLFGGAGVGKTVLIMELINNVAKAHGGYSVF AGVGERTREGNDLYHEMIESGVINLKDATSKVALVYGQ MNEPPGARARVALTGLTVAEYFRDQEGQDVLLFIDNIFRF TQAGSEVSALLGRIPSAVGYQPTLATDMGTMQERITTT KKGSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSR AIAELGIYPAVDPLDSTSRIMDPNIVGSEHYDVARGVQKI LQDYKSLQDIIAILGMDELSEEDKLTVSRARKIQRFLS QPFQVAEVFTGHMGKLVPLKETIKGFQQILAGEYDHLP EQAFYMVGPIEEAVAKADKLAEEHSS
Sequence Similarities: Belongs to the ATPase alpha/beta chains family.
Gene Name: ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide [ Homo sapiens ]
Official Symbol: ATP5B
Synonyms: ATP5B; ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide; ATPSB; ATP synthase subunit beta, mitochondrial;
Gene ID: 506
mRNA Refseq: NM_001686
Protein Refseq: NP_001677
MIM: 102910
Uniprot ID: P06576
Chromosome Location: 12p13.3
Pathway: Alzheimers disease, organism-specific biosystem; Alzheimers disease, conserved biosystem; Electron Transport Chain, organism-specific biosystem; F-type ATPase, eukaryotes, organism-specific biosystem; Formation of ATP by chemiosmotic coupling, organism-specific biosystem;
Function: ATP binding; contributes_to ATPase activity; MHC class I protein binding; calcium ion binding; eukaryotic cell surface binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.