Recombinant Mouse ATP5B protein, His-SUMO & Myc-tagged
| Cat.No. : | ATP5B-2567M |
| Product Overview : | Recombinant Mouse ATP5B protein(P56480)(230-529aa), fused to N-terminal His tag and SUMO tag and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His&Myc&SUMO |
| Protein Length : | 230-529aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 52.8 kDa |
| AA Sequence : | YSVFAGVGERTREGNDLYHEMIESGVINLKDATSKVALVYGQMNEPPGARARVALTGLTVAEYFRDQEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGTMQERITTTKKGSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSRAIAELGIYPAVDPLDSTSRIMDPNIVGNEHYDVARGVQKILQDYKSLQDIIAILGMDELSEEDKLTVSRARKIQRFLSQPFQVAEVFTGHMGKLVPLKETIKGFQQILAGEYDHLPEQAFYMVGPIEEAVAKADKLAEEHGS |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | Atp5b ATP synthase, H+ transporting mitochondrial F1 complex, beta subunit [ Mus musculus ] |
| Official Symbol | ATP5B |
| Synonyms | ATP5B; ATP synthase, H+ transporting mitochondrial F1 complex, beta subunit; ATP synthase subunit beta, mitochondrial; mitochondrial ATP synthase, H+ transporting F1 complex beta subunit; ATP synthase, H+ transporting mitochondrial F1 complex, alpha subunit; |
| Gene ID | 11947 |
| mRNA Refseq | NM_016774 |
| Protein Refseq | NP_058054 |
| ◆ Recombinant Proteins | ||
| ATP5B-3029Z | Recombinant Zebrafish ATP5B | +Inquiry |
| ATP5B-1339HF | Recombinant Full Length Human ATP5B Protein, GST-tagged | +Inquiry |
| ATP5B-977H | Recombinant Human ATP5B protein, GST-tagged | +Inquiry |
| ATP5B-859M | Recombinant Mouse ATP5B Protein, His (Fc)-Avi-tagged | +Inquiry |
| ATP5B-346M | Recombinant Mouse ATP5B Protein (47-529 aa), His-SUMO-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ATP5B-8605HCL | Recombinant Human ATP5B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ATP5B Products
Required fields are marked with *
My Review for All ATP5B Products
Required fields are marked with *



