Recombinant Mouse ATP5B protein, His-SUMO & Myc-tagged

• Cat.No.: ATP5B-2567M
• Product Overview: Recombinant Mouse ATP5B protein(P56480)(230-529aa), fused to N-terminal His tag and SUMO tag and C-terminal Myc tag, was expressed in E. coli.

Specification

• Species: Mouse
• Source: E.coli
• Tag: His&Myc&SUMO
• Protein Length: 230-529aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 52.8 kDa
• AA Sequence: YSVFAGVGERTREGNDLYHEMIESGVINLKDATSKVALVYGQMNEPPGARARVALTGLTVAEYFRDQEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGTMQERITTTKKGSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSRAIAELGIYPAVDPLDSTSRIMDPNIVGNEHYDVARGVQKILQDYKSLQDIIAILGMDELSEEDKLTVSRARKIQRFLSQPFQVAEVFTGHMGKLVPLKETIKGFQQILAGEYDHLPEQAFYMVGPIEEAVAKADKLAEEHGS
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: Atp5b ATP synthase, H+ transporting mitochondrial F1 complex, beta subunit [ Mus musculus ]
• Official Symbol: ATP5B
• Synonyms: ATP5B; ATP synthase, H+ transporting mitochondrial F1 complex, beta subunit; ATP synthase subunit beta, mitochondrial; mitochondrial ATP synthase, H+ transporting F1 complex beta subunit; ATP synthase, H+ transporting mitochondrial F1 complex, alpha subunit
• Gene ID: 11947
• mRNA Refseq: NM_016774
• Protein Refseq: NP_058054