Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at AACR Annual Meeting|Apr. 5-10, 2024|Booth #2953

Recombinant Human C20ORF20, His-tagged

Cat.No. : C20ORF20-26614TH
Product Overview : Recombinant fragment, corresponding to amino acids 22-204 of Human C20orf20 with an N terminal His tag. Predicted MWt: 22 kDa;
  • Specification
  • Gene Information
  • Related Products
Description : Component of the NuA4 histone acetyltransferase (HAT) complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histones H4 and H2A.
Conjugation : HIS
Source : E. coli
Form : Lyophilised:Reconstitute with 69 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : TSPAEETVVWSPEVEVCLFHAMLGHKPVGVNRHFHMICIR DKFSQNIGRQVPSKVIWDHLSTMYDMQALHESEILPFP NPERNFVLPEEIIQEVREGKVMIEEEMKEEMKEDVDPH NGADDVFSSSGSLGKASEKSSKDKEKNSSDLGCKEGADKR KRSRVTDKVLTANSNPSSPSAAKRRRT
Sequence Similarities : Belongs to the EAF7 family.
Gene Name : C20orf20 chromosome 20 open reading frame 20 [ Homo sapiens ]
Official Symbol : C20ORF20
Synonyms : C20ORF20; chromosome 20 open reading frame 20; MRG-binding protein; Eaf7; FLJ10914; MRG15BP; MRGBP;
Gene ID : 55257
mRNA Refseq : NM_018270
Protein Refseq : NP_060740
MIM : 611157
Uniprot ID : Q9NV56
Chromosome Location : 20q13.33

Products Types

◆ Recombinant Protein
C20orf20-1315H Recombinant Human Chromosome 20 0pen Reading Frame 20, His-tagged +Inquiry
C20orf20-301116H Recombinant Human C20orf20 protein, GST-tagged +Inquiry
C20ORF20-26617TH Recombinant Human C20ORF20, His-tagged +Inquiry

See All C20ORF20 Recombinant Protein

◆ Lysates
C20orf20-8119HCL Recombinant Human C20orf20 293 Cell Lysate +Inquiry

See All C20ORF20 Lysates

Related Gene

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (0)

Ask a question

Customer Reviews (0)

Write a review

Ask a Question for All C20ORF20 Products

Required fields are marked with *

My Review for All C20ORF20 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends