Recombinant Human C20ORF20, His-tagged
Cat.No. : | C20ORF20-26614TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 22-204 of Human C20orf20 with an N terminal His tag. Predicted MWt: 22 kDa; |
- Specification
- Gene Information
- Related Products
Description : | Component of the NuA4 histone acetyltransferase (HAT) complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histones H4 and H2A. |
Conjugation : | HIS |
Source : | E. coli |
Form : | Lyophilised:Reconstitute with 69 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | TSPAEETVVWSPEVEVCLFHAMLGHKPVGVNRHFHMICIR DKFSQNIGRQVPSKVIWDHLSTMYDMQALHESEILPFP NPERNFVLPEEIIQEVREGKVMIEEEMKEEMKEDVDPH NGADDVFSSSGSLGKASEKSSKDKEKNSSDLGCKEGADKR KRSRVTDKVLTANSNPSSPSAAKRRRT |
Sequence Similarities : | Belongs to the EAF7 family. |
Gene Name : | C20orf20 chromosome 20 open reading frame 20 [ Homo sapiens ] |
Official Symbol : | C20ORF20 |
Synonyms : | C20ORF20; chromosome 20 open reading frame 20; MRG-binding protein; Eaf7; FLJ10914; MRG15BP; MRGBP; |
Gene ID : | 55257 |
mRNA Refseq : | NM_018270 |
Protein Refseq : | NP_060740 |
MIM : | 611157 |
Uniprot ID : | Q9NV56 |
Chromosome Location : | 20q13.33 |
Products Types
◆ Recombinant Protein | ||
C20orf20-1315H | Recombinant Human Chromosome 20 0pen Reading Frame 20, His-tagged | +Inquiry |
C20orf20-301116H | Recombinant Human C20orf20 protein, GST-tagged | +Inquiry |
C20ORF20-26617TH | Recombinant Human C20ORF20, His-tagged | +Inquiry |
◆ Lysates | ||
C20orf20-8119HCL | Recombinant Human C20orf20 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (0)
Ask a questionAsk a Question for All C20ORF20 Products
Required fields are marked with *
My Review for All C20ORF20 Products
Required fields are marked with *
0
Inquiry Basket