Recombinant Human C20orf20 protein, GST-tagged
| Cat.No. : | C20orf20-301116H |
| Product Overview : | Recombinant Human C20orf20 (1-204 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | Met1-Thr204 |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| AA Sequence : | MGEAEVGGGGAAGDKGPGEAATSPAEETVVWSPEVEVCLFHAMLGHKPVGVNRHFHMICIRDKFSQNIGRQVPSKVIWDHLSTMYDMQALHESEILPFPNPERNFVLPEEIIQEVREGKVMIEEEMKEEMKEDVDPHNGADDVFSSSGSLGKASEKSSKDKEKNSSDLGCKEGADKRKRSRVTDKVLTANSNPSSPSAAKRRRT |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Gene Name | C20orf20 chromosome 20 open reading frame 20 [ Homo sapiens ] |
| Official Symbol | C20orf20 |
| Synonyms | C20ORF20; chromosome 20 open reading frame 20; MRG-binding protein; Eaf7; FLJ10914; MRG15BP; MRGBP; MRG(MORF4-related gene)-binding protein; URCC4; |
| Gene ID | 55257 |
| mRNA Refseq | NM_018270 |
| Protein Refseq | NP_060740 |
| MIM | 611157 |
| UniProt ID | Q9NV56 |
| ◆ Recombinant Proteins | ||
| C20orf20-1315H | Recombinant Human Chromosome 20 0pen Reading Frame 20, His-tagged | +Inquiry |
| C20ORF20-26617TH | Recombinant Human C20ORF20, His-tagged | +Inquiry |
| C20orf20-301116H | Recombinant Human C20orf20 protein, GST-tagged | +Inquiry |
| C20ORF20-26614TH | Recombinant Human C20ORF20, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| C20orf20-8119HCL | Recombinant Human C20orf20 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All C20orf20 Products
Required fields are marked with *
My Review for All C20orf20 Products
Required fields are marked with *
