Recombinant Human C20ORF20, His-tagged
Cat.No. : | C20ORF20-26614TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 22-204 of Human C20orf20 with an N terminal His tag. Predicted MWt: 22 kDa; |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 22-204 a.a. |
Description : | Component of the NuA4 histone acetyltransferase (HAT) complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histones H4 and H2A. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitute with 69 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | TSPAEETVVWSPEVEVCLFHAMLGHKPVGVNRHFHMICIR DKFSQNIGRQVPSKVIWDHLSTMYDMQALHESEILPFP NPERNFVLPEEIIQEVREGKVMIEEEMKEEMKEDVDPH NGADDVFSSSGSLGKASEKSSKDKEKNSSDLGCKEGADKR KRSRVTDKVLTANSNPSSPSAAKRRRT |
Sequence Similarities : | Belongs to the EAF7 family. |
Gene Name | C20orf20 chromosome 20 open reading frame 20 [ Homo sapiens ] |
Official Symbol | C20ORF20 |
Synonyms | C20ORF20; chromosome 20 open reading frame 20; MRG-binding protein; Eaf7; FLJ10914; MRG15BP; MRGBP; |
Gene ID | 55257 |
mRNA Refseq | NM_018270 |
Protein Refseq | NP_060740 |
MIM | 611157 |
Uniprot ID | Q9NV56 |
Chromosome Location | 20q13.33 |
◆ Recombinant Proteins | ||
C20ORF20-26614TH | Recombinant Human C20ORF20, His-tagged | +Inquiry |
C20orf20-1315H | Recombinant Human Chromosome 20 0pen Reading Frame 20, His-tagged | +Inquiry |
C20ORF20-26617TH | Recombinant Human C20ORF20, His-tagged | +Inquiry |
C20orf20-301116H | Recombinant Human C20orf20 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
C20orf20-8119HCL | Recombinant Human C20orf20 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All C20ORF20 Products
Required fields are marked with *
My Review for All C20ORF20 Products
Required fields are marked with *