Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at AACR Annual Meeting|Apr. 5-10, 2024|Booth #2953

Recombinant Human CD38

Cat.No. : CD38-27749TH
Product Overview : Recombinant full length Human CD38 with a N terminal proprietary tag: predicted molecular weight 59.11 kDa.
  • Specification
  • Gene Information
  • Related Products
Description : CD38 is a novel multifunctional ectoenzyme widely expressed in cells and tissues especially in leukocytes. CD38 also functions in cell adhesion,signal transduction and calcium signaling.
Protein length : 300 amino acids
Molecular Weight : 59.110kDa inclusive of tags
Source : Wheat germ
Tissue specificity : Expressed at high levels in pancreas, liver, kidney, brain, testis, ovary, placenta, malignant lymphoma and neuroblastoma.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MANCEFSPVSGDKPCCRLSRRAQLCLGVSILVLILVVVLA VVVPRWRQQWSGPGTTKRFPETVLARCVKYTEIHPEMRHV DCQSVWDAFKGAFISKHPCNITEEDYQPLMKLGTQTVPCN KILLWSRIKDLAHQFTQVQRDMFTLEDTLLGYLADDLTWC GEFNTSKINYQSCPDWRKDCSNNPVSVFWKTVSRRFAEAA CDVVHAMLNGSRSKIFDKNSTFGSVEVHNLQPEKVQTLEA WVIHGGREDSRDLCQDPTIKELESIISKRNIQFSCKNIYR PDKFLQCVKNPEDSSCTSEI
Sequence Similarities : Belongs to the ADP-ribosyl cyclase family.
Gene Name : CD38 CD38 molecule [ Homo sapiens ]
Official Symbol : CD38
Synonyms : CD38; CD38 molecule; CD38 antigen (p45); ADP-ribosyl cyclase 1; ADP ribosyl cyclase 1; NAD(+) nucleosidase;
Gene ID : 952
mRNA Refseq : NM_001775
Protein Refseq : NP_001766
MIM : 107270
Uniprot ID : P28907
Chromosome Location : 4p15.32
Pathway : Calcium signaling pathway, organism-specific biosystem; Calcium signaling pathway, conserved biosystem; Hematopoietic cell lineage, organism-specific biosystem; Hematopoietic cell lineage, conserved biosystem; Metabolic pathways, organism-specific biosystem;
Function : NAD+ nucleosidase activity; hydrolase activity, acting on glycosyl bonds; nucleotide binding; phosphorus-oxygen lyase activity; receptor activity;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (7)

Ask a question
What are the challenges and future directions in CD38 research? 04/06/2023

 CD38 research faces several challenges and offers exciting future directions. One challenge is deciphering the precise molecular mechanisms by which CD38 modulates cellular processes and interacts with other proteins. Additionally, understanding the context-dependent functions of CD38 in different cell types and disease conditions requires further investigation. Future directions include exploring the therapeutic potential of CD38 inhibitors in combination with other treatment modalities, investigating the role of CD38 in the tumor microenvironment, and advancing our understanding of the dynamic regulation of CD38 expression and activity. Such advancements will pave the way for personalized medicine approaches targeting CD38 in various diseases.

What are the functions and mechanisms of protein CD38 in biological systems? 02/15/2023

Protein CD38 is a transmembrane enzyme that plays a crucial role in various biological processes. Its main function is the hydrolysis of NAD+ to generate ADP-ribose, leading to the production of cyclic ADP-ribose (cADPR) and ADP-ribose (ADPR) as intracellular calcium signaling molecules. CD38 is involved in regulating cell proliferation, apoptosis, and immune responses. Its mechanisms of action include modulation of intracellular signaling pathways, such as cADPR-mediated calcium release and involvement in apoptotic pathways through ADPR.

Does CD38 interact with other proteins or signaling pathways? 01/08/2023

Yes, CD38 exhibits interactions with several proteins and signaling pathways. For instance, CD38 is involved in the regulation of calcium signaling by interacting with calcium channels and receptors. It also interacts with other proteins in the NAD+ metabolism pathway, such as NAD+-consuming enzymes and NAD+ synthesizing enzymes. Furthermore, CD38 can modulate immune responses by interacting with immune cell receptors and co-stimulatory molecules. Understanding these protein-protein interactions and their functional consequences is essential for comprehending the broader role of CD38 in cellular processes and disease pathogenesis.

What are the current areas of research focus regarding CD38? 12/08/2022

Current research on CD38 encompasses various aspects. One area of focus is elucidating the role of CD38 in disease pathogenesis, including its involvement in cancer progression, autoimmune disorders, and neurodegenerative diseases. Researchers are also investigating the potential of CD38 as a diagnostic and prognostic marker in different diseases. Additionally, efforts are being made to identify novel therapeutic targets within the CD38 signaling pathway and develop more effective and specific CD38 inhibitors. Understanding the complex regulatory mechanisms and functional consequences of CD38 will contribute to the development of targeted therapies and precision medicine approaches.

Are there any genetic variations or polymorphisms associated with CD38 expression or function? 11/22/2022

Yes, genetic variations in the CD38 gene have been identified, and some of these variations have been associated with altered CD38 expression or function. For example, certain single nucleotide polymorphisms (SNPs) in the CD38 gene have been linked to changes in CD38 enzyme activity and NAD+ metabolism. These genetic variations can influence immune responses, susceptibility to certain diseases, and response to therapies targeted at CD38.

In which cell types is CD38 expressed and considered important? 01/11/2020

CD38 is widely expressed in various cell types, including immune cells (such as lymphocytes, monocytes, dendritic cells, etc.), neuronal cells, endothelial cells, and several others. It is especially important in immune cells, where it plays a critical role in immune responses, such as T cell activation, B cell differentiation, and antibody production. CD38 expression in neuronal cells has been linked to neurotransmitter release and synaptic plasticity. Additionally, CD38 expression in endothelial cells is associated with regulating vascular function and inflammation.

What are the potential therapeutic implications of targeting CD38? 06/17/2016

Targeting CD38 has gained significant attention in the development of therapeutic strategies. CD38 inhibitors, such as monoclonal antibodies, have shown promising results in the treatment of hematological malignancies, particularly multiple myeloma. These inhibitors block CD38 enzymatic activity, leading to impaired tumor cell growth, enhanced immune responses, and induction of cell death. Moreover, CD38-targeted therapies have also been explored for autoimmune diseases and inflammatory disorders. Further research is underway to optimize CD38-targeted therapies and expand their applications in different disease settings.

Customer Reviews (3)

Write a review
Reviews
01/15/2021

    By employing this protein reagent, I can swiftly obtain sufficient protein samples, meeting the high demand for experiments.

    06/11/2019

      The consumable costs associated with this protein reagent are relatively low, rendering it economically feasible and efficient for large-scale applications in the laboratory.

      06/08/2019

        A magical partner in experimentation, taking your research to new heights.

        Ask a Question for All CD38 Products

        Required fields are marked with *

        My Review for All CD38 Products

        Required fields are marked with *

        0

        Inquiry Basket

        cartIcon
        logo

        FOLLOW US

        Terms and Conditions        Privacy Policy

        Copyright © 2024 Creative BioMart. All Rights Reserved.

        Contact Us

        • /

        Stay Updated on the Latest Bioscience Trends