Recombinant Human CD38 CD38-27749TH

Recombinant Human CD38

PRODUCTS

Home / Products / Recombinant Human CD38

Recombinant Human CD38

CD38 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : CD38-27749TH
Product Overview : Recombinant full length Human CD38 with a N terminal proprietary tag: predicted molecular weight 59.11 kDa.
Description : CD38 is a novel multifunctional ectoenzyme widely expressed in cells and tissues especially in leukocytes. CD38 also functions in cell adhesion,signal transduction and calcium signaling.
Protein length : 300 amino acids
Molecular Weight : 59.110kDa inclusive of tags
Source : Wheat germ
Tissue specificity : Expressed at high levels in pancreas, liver, kidney, brain, testis, ovary, placenta, malignant lymphoma and neuroblastoma.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MANCEFSPVSGDKPCCRLSRRAQLCLGVSILVLILVVVLA VVVPRWRQQWSGPGTTKRFPETVLARCVKYTEIHPEMRHV DCQSVWDAFKGAFISKHPCNITEEDYQPLMKLGTQTVPCN KILLWSRIKDLAHQFTQVQRDMFTLEDTLLGYLADDLTWC GEFNTSKINYQSCPDWRKDCSNNPVSVFWKTVSRRFAEAA CDVVHAMLNGSRSKIFDKNSTFGSVEVHNLQPEKVQTLEA WVIHGGREDSRDLCQDPTIKELESIISKRNIQFSCKNIYR PDKFLQCVKNPEDSSCTSEI
Sequence Similarities : Belongs to the ADP-ribosyl cyclase family.
Gene Name : CD38 CD38 molecule [ Homo sapiens ]
Official Symbol : CD38
Synonyms : CD38; CD38 molecule; CD38 antigen (p45); ADP-ribosyl cyclase 1; ADP ribosyl cyclase 1; NAD(+) nucleosidase;
Gene ID : 952
mRNA Refseq : NM_001775
Protein Refseq : NP_001766
MIM : 107270
Uniprot ID : P28907
Chromosome Location : 4p15.32
Pathway : Calcium signaling pathway, organism-specific biosystem; Calcium signaling pathway, conserved biosystem; Hematopoietic cell lineage, organism-specific biosystem; Hematopoietic cell lineage, conserved biosystem; Metabolic pathways, organism-specific biosystem;
Function : NAD+ nucleosidase activity; hydrolase activity, acting on glycosyl bonds; nucleotide binding; phosphorus-oxygen lyase activity; receptor activity;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy