"CD38" Related Products

Expand
Expand
Expand

Recombinant Human CD38

Cat.No.: CD38-27749TH
Product Overview: Recombinant full length Human CD38 with a N terminal proprietary tag: predicted molecular weight 59.11 kDa.
Description: CD38 is a novel multifunctional ectoenzyme widely expressed in cells and tissues especially in leukocytes. CD38 also functions in cell adhesion,signal transduction and calcium signaling.
Protein length: 300 amino acids
Molecular Weight: 59.110kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Expressed at high levels in pancreas, liver, kidney, brain, testis, ovary, placenta, malignant lymphoma and neuroblastoma.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MANCEFSPVSGDKPCCRLSRRAQLCLGVSILVLILVVVLA VVVPRWRQQWSGPGTTKRFPETVLARCVKYTEIHPEMRHV DCQSVWDAFKGAFISKHPCNITEEDYQPLMKLGTQTVPCN KILLWSRIKDLAHQFTQVQRDMFTLEDTLLGYLADDLTWC GEFNTSKINYQSCPDWRKDCSNNPVSVFWKTVSRRFAEAA CDVVHAMLNGSRSKIFDKNSTFGSVEVHNLQPEKVQTLEA WVIHGGREDSRDLCQDPTIKELESIISKRNIQFSCKNIYR PDKFLQCVKNPEDSSCTSEI
Sequence Similarities: Belongs to the ADP-ribosyl cyclase family.
Gene Name: CD38 CD38 molecule [ Homo sapiens ]
Official Symbol: CD38
Synonyms: CD38; CD38 molecule; CD38 antigen (p45); ADP-ribosyl cyclase 1; ADP ribosyl cyclase 1; NAD(+) nucleosidase;
Gene ID: 952
mRNA Refseq: NM_001775
Protein Refseq: NP_001766
MIM: 107270
Uniprot ID: P28907
Chromosome Location: 4p15.32
Pathway: Calcium signaling pathway, organism-specific biosystem; Calcium signaling pathway, conserved biosystem; Hematopoietic cell lineage, organism-specific biosystem; Hematopoietic cell lineage, conserved biosystem; Metabolic pathways, organism-specific biosystem;
Function: NAD+ nucleosidase activity; hydrolase activity, acting on glycosyl bonds; nucleotide binding; phosphorus-oxygen lyase activity; receptor activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.