Recombinant Human CD38
| Cat.No. : | CD38-27749TH |
| Product Overview : | Recombinant full length Human CD38 with a N terminal proprietary tag: predicted molecular weight 59.11 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 300 amino acids |
| Description : | CD38 is a novel multifunctional ectoenzyme widely expressed in cells and tissues especially in leukocytes. CD38 also functions in cell adhesion,signal transduction and calcium signaling. |
| Molecular Weight : | 59.110kDa inclusive of tags |
| Tissue specificity : | Expressed at high levels in pancreas, liver, kidney, brain, testis, ovary, placenta, malignant lymphoma and neuroblastoma. |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | MANCEFSPVSGDKPCCRLSRRAQLCLGVSILVLILVVVLA VVVPRWRQQWSGPGTTKRFPETVLARCVKYTEIHPEMRHV DCQSVWDAFKGAFISKHPCNITEEDYQPLMKLGTQTVPCN KILLWSRIKDLAHQFTQVQRDMFTLEDTLLGYLADDLTWC GEFNTSKINYQSCPDWRKDCSNNPVSVFWKTVSRRFAEAA CDVVHAMLNGSRSKIFDKNSTFGSVEVHNLQPEKVQTLEA WVIHGGREDSRDLCQDPTIKELESIISKRNIQFSCKNIYR PDKFLQCVKNPEDSSCTSEI |
| Sequence Similarities : | Belongs to the ADP-ribosyl cyclase family. |
| Gene Name | CD38 CD38 molecule [ Homo sapiens ] |
| Official Symbol | CD38 |
| Synonyms | CD38; CD38 molecule; CD38 antigen (p45); ADP-ribosyl cyclase 1; ADP ribosyl cyclase 1; NAD(+) nucleosidase; |
| Gene ID | 952 |
| mRNA Refseq | NM_001775 |
| Protein Refseq | NP_001766 |
| MIM | 107270 |
| Uniprot ID | P28907 |
| Chromosome Location | 4p15.32 |
| Pathway | Calcium signaling pathway, organism-specific biosystem; Calcium signaling pathway, conserved biosystem; Hematopoietic cell lineage, organism-specific biosystem; Hematopoietic cell lineage, conserved biosystem; Metabolic pathways, organism-specific biosystem; |
| Function | NAD+ nucleosidase activity; hydrolase activity, acting on glycosyl bonds; nucleotide binding; phosphorus-oxygen lyase activity; receptor activity; |
| ◆ Recombinant Proteins | ||
| CD38-737R | Recombinant Rhesus monkey CD38 Protein, His-tagged | +Inquiry |
| CD38-654H | Recombinant Human CD38 protein, His/Flag-tagged | +Inquiry |
| CD38-136C | Recombinant Cynomolgus Monkey CD38 Protein, His (Fc)-Avi-tagged | +Inquiry |
| CD38-574HAF647 | Active Recombinant Human CD38 Protein, Fc-tagged, Alexa Fluor 647 conjugated | +Inquiry |
| CD38-58HF | Recombinant Full Length Human CD38 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CD38-1557HCL | Recombinant Human CD38 cell lysate | +Inquiry |
| CD38-2639MCL | Recombinant Mouse CD38 cell lysate | +Inquiry |
| CD38-1259RCL | Recombinant Rat CD38 cell lysate | +Inquiry |
| CD38-1398CCL | Recombinant Cynomolgus CD38 cell lysate | +Inquiry |
| CD38-1025RCL | Recombinant Rabbit CD38 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD38 Products
Required fields are marked with *
My Review for All CD38 Products
Required fields are marked with *
