Recombinant Full Length Human CD38 Protein
Cat.No. : | CD38-58HF |
Product Overview : | Recombinant full length Human CD38 with a N terminal proprietary tag: predicted molecular weight 59.11 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Protein Length : | 300 amino acids |
Description : | CD38 is a novel multifunctional ectoenzyme widely expressed in cells and tissues especially in leukocytes. CD38 also functions in cell adhesion,signal transduction and calcium signaling. |
Form : | Liquid |
Molecular Mass : | 59.110kDa inclusive of tags |
AA Sequence : | MANCEFSPVSGDKPCCRLSRRAQLCLGVSILVLILVVVLA VVVPRWRQQWSGPGTTKRFPETVLARCVKYTEIHPEMRHV DCQSVWDAFKGAFISKHPCNITEEDYQPLMKLGTQTVPCN KILLWSRIKDLAHQFTQVQRDMFTLEDTLLGYLADDLTWC GEFNTSKINYQSCPDWRKDCSNNPVSVFWKTVSRRFAEAA CDVVHAMLNGSRSKIFDKNSTFGSVEVHNLQPEKVQTLEA WVIHGGREDSRDLCQDPTIKELESIISKRNIQFSCKNIYR PDKFLQCVKNPEDSSCTSEI |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name | CD38 CD38 molecule [ Homo sapiens ] |
Official Symbol | CD38 |
Synonyms | CD38; CD38 molecule; CD38 antigen (p45); ADP-ribosyl cyclase 1; ADP ribosyl cyclase 1; NAD(+) nucleosidase |
Gene ID | 952 |
mRNA Refseq | NM_001775 |
Protein Refseq | NP_001766 |
MIM | 107270 |
UniProt ID | P28907 |
◆ Recombinant Proteins | ||
CD38-574HAF555 | Active Recombinant Human CD38 Protein, Fc-tagged, Alexa Fluor 555 conjugated | +Inquiry |
CD38-361H | Active Recombinant Human CD38 Protein, LIgG2b Fc-tagged, low endotoxin | +Inquiry |
CD38-5349H | Recombinant Human CD38 Protein (Val43-Ile300), C-His tagged | +Inquiry |
CD38-27749TH | Recombinant Human CD38 | +Inquiry |
CD38-0696H | Recombinant Human CD38 Protein (Met1-Ile300), His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD38-1398CCL | Recombinant Cynomolgus CD38 cell lysate | +Inquiry |
CD38-2639MCL | Recombinant Mouse CD38 cell lysate | +Inquiry |
CD38-1259RCL | Recombinant Rat CD38 cell lysate | +Inquiry |
CD38-1557HCL | Recombinant Human CD38 cell lysate | +Inquiry |
CD38-1025RCL | Recombinant Rabbit CD38 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CD38 Products
Required fields are marked with *
My Review for All CD38 Products
Required fields are marked with *
0
Inquiry Basket