Recombinant Full Length Human CD38 Protein
| Cat.No. : | CD38-58HF |
| Product Overview : | Recombinant full length Human CD38 with a N terminal proprietary tag: predicted molecular weight 59.11 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Protein Length : | 300 amino acids |
| Description : | CD38 is a novel multifunctional ectoenzyme widely expressed in cells and tissues especially in leukocytes. CD38 also functions in cell adhesion,signal transduction and calcium signaling. |
| Form : | Liquid |
| Molecular Mass : | 59.110kDa inclusive of tags |
| AA Sequence : | MANCEFSPVSGDKPCCRLSRRAQLCLGVSILVLILVVVLA VVVPRWRQQWSGPGTTKRFPETVLARCVKYTEIHPEMRHV DCQSVWDAFKGAFISKHPCNITEEDYQPLMKLGTQTVPCN KILLWSRIKDLAHQFTQVQRDMFTLEDTLLGYLADDLTWC GEFNTSKINYQSCPDWRKDCSNNPVSVFWKTVSRRFAEAA CDVVHAMLNGSRSKIFDKNSTFGSVEVHNLQPEKVQTLEA WVIHGGREDSRDLCQDPTIKELESIISKRNIQFSCKNIYR PDKFLQCVKNPEDSSCTSEI |
| Purity : | Proprietary Purification |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
| Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
| Gene Name | CD38 CD38 molecule [ Homo sapiens ] |
| Official Symbol | CD38 |
| Synonyms | CD38; CD38 molecule; CD38 antigen (p45); ADP-ribosyl cyclase 1; ADP ribosyl cyclase 1; NAD(+) nucleosidase |
| Gene ID | 952 |
| mRNA Refseq | NM_001775 |
| Protein Refseq | NP_001766 |
| MIM | 107270 |
| UniProt ID | P28907 |
| ◆ Recombinant Proteins | ||
| CD38-388C | Recombinant Cynomolgus CD38 Protein, His-tagged | +Inquiry |
| RFL31242MF | Recombinant Full Length Mouse Adp-Ribosyl Cyclase 1(Cd38) Protein, His-Tagged | +Inquiry |
| Cd38-8742RAF488 | Recombinant Rat Cd38 Protein, Fc-tagged, Alexa Fluor 488 conjugated | +Inquiry |
| CD38-4996H | Recombinant Human CD38 protein, hFc-tagged | +Inquiry |
| CD38-30H | Recombinant Human CD38 Protein (ECD), His-tagged(C-ter) | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CD38-1557HCL | Recombinant Human CD38 cell lysate | +Inquiry |
| CD38-1025RCL | Recombinant Rabbit CD38 cell lysate | +Inquiry |
| CD38-1259RCL | Recombinant Rat CD38 cell lysate | +Inquiry |
| CD38-2639MCL | Recombinant Mouse CD38 cell lysate | +Inquiry |
| CD38-1398CCL | Recombinant Cynomolgus CD38 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD38 Products
Required fields are marked with *
My Review for All CD38 Products
Required fields are marked with *
