Recombinant Human CLDN2

Cat.No. : CLDN2-26706TH
Product Overview : Recombinant fragment of HumanClaudin 2 with a proprietary tag: predicted molecular weight 31.35 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 52 amino acids
Description : This gene product belongs to the claudin protein family whose members have been identified as major integral membrane proteins localized exclusively at tight junctions. Claudins are expressed in an organ-specific manner and regulate tissue-specific physiologic properties of tight junctions. This protein is expressed in the intestine. Alternatively spliced transcript variants with different 5 untranslated region have been found for this gene.
Molecular Weight : 31.350kDa inclusive of tags
Biological activity : Useful for Antibody Production and Protein Array
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.79% Tris HCl, 0.31% GlutathioneNote: Glutathione is reduced
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : SWKTSSYVGASIVTAVGFSKGLWMECATHSTGITQCDIYSTLLGLPADIQAA
Sequence Similarities : Belongs to the claudin family.
Gene Name CLDN2 claudin 2 [ Homo sapiens ]
Official Symbol CLDN2
Synonyms CLDN2; claudin 2; claudin-2;
Gene ID 9075
mRNA Refseq NM_001171092
Protein Refseq NP_001164563
MIM 300520
Uniprot ID P57739
Chromosome Location Xq22.3-q23
Pathway Cell adhesion molecules (CAMs), organism-specific biosystem; Cell adhesion molecules (CAMs), conserved biosystem; Cell junction organization, organism-specific biosystem; Cell-Cell communication, organism-specific biosystem; Cell-cell junction organization, organism-specific biosystem;
Function identical protein binding; structural molecule activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CLDN2 Products

Required fields are marked with *

My Review for All CLDN2 Products

Required fields are marked with *

0
cart-icon
0
compare icon