Recombinant Human CLDN2

• Cat.No.: CLDN2-26706TH
• Product Overview: Recombinant fragment of HumanClaudin 2 with a proprietary tag: predicted molecular weight 31.35 kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 52 amino acids
• Description: This gene product belongs to the claudin protein family whose members have been identified as major integral membrane proteins localized exclusively at tight junctions. Claudins are expressed in an organ-specific manner and regulate tissue-specific physiologic properties of tight junctions. This protein is expressed in the intestine. Alternatively spliced transcript variants with different 5 untranslated region have been found for this gene.
• Molecular Weight: 31.350kDa inclusive of tags
• Biological activity: Useful for Antibody Production and Protein Array
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.31% GlutathioneNote: Glutathione is reduced
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: SWKTSSYVGASIVTAVGFSKGLWMECATHSTGITQCDIYSTLLGLPADIQAA
• Sequence Similarities: Belongs to the claudin family.

Gene Information

• Gene Name: CLDN2 claudin 2 [ Homo sapiens ]
• Official Symbol: CLDN2
• Synonyms: CLDN2; claudin 2; claudin-2
• Gene ID: 9075
• mRNA Refseq: NM_001171092
• Protein Refseq: NP_001164563
• MIM: 300520
• Uniprot ID: P57739
• Chromosome Location: Xq22.3-q23
• Pathway: Cell adhesion molecules (CAMs), organism-specific biosystem; Cell adhesion molecules (CAMs), conserved biosystem; Cell junction organization, organism-specific biosystem; Cell-Cell communication, organism-specific biosystem; Cell-cell junction organization, organism-specific biosystem
• Function: identical protein binding; structural molecule activity