"CLDN2" Related Products

Expand

Recombinant Human CLDN2

Cat.No.: CLDN2-26706TH
Product Overview: Recombinant fragment of HumanClaudin 2 with a proprietary tag: predicted molecular weight 31.35 kDa.
Description: This gene product belongs to the claudin protein family whose members have been identified as major integral membrane proteins localized exclusively at tight junctions. Claudins are expressed in an organ-specific manner and regulate tissue-specific physiologic properties of tight junctions. This protein is expressed in the intestine. Alternatively spliced transcript variants with different 5 untranslated region have been found for this gene.
Protein length: 52 amino acids
Molecular Weight: 31.350kDa inclusive of tags
Source: Wheat germ
Biological activity: Useful for Antibody Production and Protein Array
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.31% GlutathioneNote: Glutathione is reduced
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: SWKTSSYVGASIVTAVGFSKGLWMECATHSTGITQCDIYSTLLGLPADIQAA
Sequence Similarities: Belongs to the claudin family.
Gene Name: CLDN2 claudin 2 [ Homo sapiens ]
Official Symbol: CLDN2
Synonyms: CLDN2; claudin 2; claudin-2;
Gene ID: 9075
mRNA Refseq: NM_001171092
Protein Refseq: NP_001164563
MIM: 300520
Uniprot ID: P57739
Chromosome Location: Xq22.3-q23
Pathway: Cell adhesion molecules (CAMs), organism-specific biosystem; Cell adhesion molecules (CAMs), conserved biosystem; Cell junction organization, organism-specific biosystem; Cell-Cell communication, organism-specific biosystem; Cell-cell junction organization, organism-specific biosystem;
Function: identical protein binding; structural molecule activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.