Recombinant Human CLDN2 Protein, His-tagged

• Cat.No.: CLDN2-11293H
• Product Overview: Recombinant Human CLDN2 Protein(184-230 aa), fused with N-terminal His tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 184-230 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AASequence: SCSSQRNRSNYYDAYQAQPLATRSSPRPGQPPKVKSEFNSYSLTGYV
• Purity: 80%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage.

Gene Information

• Gene Name: CLDN2 claudin 2 [ Homo sapiens ]
• Official Symbol: CLDN2
• Synonyms: CLDN2; claudin 2; claudin-2; SP82
• Gene ID: 9075
• mRNA Refseq: NM_001171092
• Protein Refseq: NP_001164563
• MIM: 300520
• UniProt ID: P57739