Recombinant Human CLDN2 Protein, His-tagged
Cat.No. : | CLDN2-11293H |
Product Overview : | Recombinant Human CLDN2 Protein(184-230 aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 184-230 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AASequence : | SCSSQRNRSNYYDAYQAQPLATRSSPRPGQPPKVKSEFNSYSLTGYV |
Purity : | 80%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
Gene Name | CLDN2 claudin 2 [ Homo sapiens ] |
Official Symbol | CLDN2 |
Synonyms | CLDN2; claudin 2; claudin-2; SP82; |
Gene ID | 9075 |
mRNA Refseq | NM_001171092 |
Protein Refseq | NP_001164563 |
MIM | 300520 |
UniProt ID | P57739 |
◆ Recombinant Proteins | ||
CLDN2-5001C | Recombinant Chicken CLDN2 | +Inquiry |
CLDN2-1282Z | Recombinant Zebrafish CLDN2 | +Inquiry |
CLDN2-0405H | Recombinant Human CLDN2 Protein (Met1-Val230), C-His-tagged | +Inquiry |
CLDN2-11293H | Recombinant Human CLDN2 Protein, His-tagged | +Inquiry |
CLDN2-1438H | Recombinant Human CLDN2 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CLDN2-7466HCL | Recombinant Human CLDN2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CLDN2 Products
Required fields are marked with *
My Review for All CLDN2 Products
Required fields are marked with *