Recombinant Human CLDN2 protein(184-230 aa), GST-tagged

Cat.No. : CLDN2-11292H
Product Overview : Recombinant Human CLDN2 protein(184-230 aa), fused with N-terminal GST tag, was expressed in E.coli.
Availability August 02, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Case Study
  • Application
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 184-230 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
Purity : 80%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage.
AA Sequence : SCSSQRNRSNYYDAYQAQPLATRSSPRPGQPPKVKSEFNSYSLTGYV
Gene Name CLDN2 claudin 2 [ Homo sapiens ]
Official Symbol CLDN2
Synonyms CLDN2; claudin 2; claudin-2; SP82
Gene ID 9075
mRNA Refseq NM_001171092
Protein Refseq NP_001164563
MIM 300520
UniProt ID P57739

Case 1: Tabariès S, et al. Commun Biol. 2021

Claudin-2 aids in liver metastasis of breast and colorectal cancers by supporting early cancer cell survival. It's linked to worse survival outcomes in colorectal cancer. Studies show higher Claudin-2 in replacement-type liver metastases, while Claudin-8 is up in desmoplastic types. Patient-derived xenografts show the same pattern. Claudin-2 in extracellular vesicles could identify liver metastasis types in colorectal cancer, guiding personalized treatment plans.

Fig1. Detailed assessment of the Claudin-2/Tubulin ratio in the mixed lesions.

Fig2. Immunoblot analysis of Claudin-2 and TSG101 using lysates prepared from EVs concentrated from patients.

Case 2: Hichino A, et al. J Biol Chem. 2017

Claudin-2 levels are high in lung adenocarcinoma, promoting cell growth. While specific drugs aren't available, azacitidine (AZA) and HDAC inhibitors like TSA and NaB show promise in lowering claudin-2. AZA works by blocking PI3K/Akt/NF-κB, while HDAC inhibitors boost miR-497 to destabilize claudin-2 mRNA. These treatments together reduce cancer cell growth, hinting that epigenetic inhibitors could be effective in controlling claudin-2-rich lung adenocarcinoma.

Fig1. Expression levels of claudin-1, claudin-2, occludin, and E-cadherin are represented as percentage of the values in 0 μm.

Fig2. Mock and claudin-2 expression vectors were transfected into A549 cells.

Recombinant CLDN2 protein is pretty intriguing because it has several important applications, especially in research and potential therapies. One of its key roles is in studying epithelial cell tight junctions. Think of these junctions as security gates in your cells, deciding what gets in and out. By using recombinant CLDN2 protein, scientists can explore how these gates function in maintaining cell integrity. This understanding is crucial, particularly when looking at diseases like inflammatory bowel disease, where these barriers can break down. In addition, recombinant CLDN2 protein is a valuable player in drug development. Researchers use it to study how drugs can better move through cellular barriers, which is important when creating treatments that need to penetrate deep into tissues. Take cancer treatment, for instance—by tweaking how drugs pass through these barriers, therapies can become more effective. So, recombinant CLDN2 protein is not only essential for understanding cellular biology but also holds promise for advancing disease treatments.

Fig1. Claudin-2 structure and interactions with cytosolic multidomain adapters. (Shruthi Venugopal, 2019)

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CLDN2 Products

Required fields are marked with *

My Review for All CLDN2 Products

Required fields are marked with *

0
cart-icon