"CSE1L" Related Products

Expand
Expand

Recombinant Human CSE1L

Cat.No.: CSE1L-27394TH
Product Overview: Recombinant fragment of Human Cellular Apoptosis Susceptibility with N terminal proprietary tag, predicted mwt: 36.63 kDa.
Description: Proteins that carry a nuclear localization signal (NLS) are transported into the nucleus by the importin-alpha/beta heterodimer. Importin-alpha binds the NLS, while importin-beta mediates translocation through the nuclear pore complex. After translocation, RanGTP binds importin-beta and displaces importin-alpha. Importin-alpha must then be returned to the cytoplasm, leaving the NLS protein behind. The protein encoded by this gene binds strongly to NLS-free importin-alpha, and this binding is released in the cytoplasm by the combined action of RANBP1 and RANGAP1. In addition, the encoded protein may play a role both in apoptosis and in cell proliferation.
Protein length: 100 amino acids
Molecular Weight: 36.630kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Highly expressed in proliferating cells.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: LIGLFELPEDDTIPDEEHFIDIEDTPGYQTAFSQLAFAGKKEHDPVGQMVNNPKIHLAQSLHKLSTACPGRVPSMVSTSLNAEALQYLQGYLQAASVTLL
Sequence Similarities: Belongs to the XPO2/CSE1 family.Contains 1 importin N-terminal domain.
Gene Name: CSE1L CSE1 chromosome segregation 1-like (yeast) [ Homo sapiens ]
Official Symbol: CSE1L
Synonyms: CSE1L; CSE1 chromosome segregation 1-like (yeast); chromosome segregation 1 (yeast homolog) like; exportin-2; CAS; CSE1; XPO2;
Gene ID: 1434
mRNA Refseq: NM_001316
Protein Refseq: NP_001307
MIM: 601342
Uniprot ID: P55060
Chromosome Location: 20q13
Pathway: Direct p53 effectors, organism-specific biosystem; p53 pathway, organism-specific biosystem;
Function: importin-alpha export receptor activity; protein binding; protein transporter activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.