"DEFA6" Related Products

Expand
Expand

Recombinant Human DEFA6

Cat.No.: DEFA6-26996TH
Product Overview: Recombinant full length Human DEFA6 , with N terminal proprietary tag; Predicted MW 37.07kDa.
Description: Defensins are a family of microbicidal and cytotoxic peptides thought to be involved in host defense. They are abundant in the granules of neutrophils and also found in the epithelia of mucosal surfaces such as those of the intestine, respiratory tract, urinary tract, and vagina. Members of the defensin family are highly similar in protein sequence and distinguished by a conserved cysteine motif. Several alpha defensin genes appear to be clustered on chromosome 8. The protein encoded by this gene, defensin, alpha 6, is highly expressed in the secretory granules of Paneth cells of the small intestine, and likely plays a role in host defense of human bowel.
Protein length: 100 amino acids
Molecular Weight: 37.070kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Paneth cells of the small intestine.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MRTLTILTAVLLVALQAKAEPLQAEDDPLQAKAYEADAQEQRGANDQDFAVSFAEDASSSLRALGSTRAFTCHCRRSCYSTEYSYGTCTVMGINHRFCCL
Sequence Similarities: Belongs to the alpha-defensin family.
Gene Name: DEFA6 defensin, alpha 6, Paneth cell-specific [ Homo sapiens ]
Official Symbol: DEFA6
Synonyms: DEFA6; defensin, alpha 6, Paneth cell-specific; defensin-6; DEF6; HD 6;
Gene ID: 1671
mRNA Refseq: NM_001926
Protein Refseq: NP_001917
MIM: 600471
Uniprot ID: Q01524
Chromosome Location: 8p23.1

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.