Recombinant Human DEFA6 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | DEFA6-4854H |
Product Overview : | DEFA6 MS Standard C13 and N15-labeled recombinant protein (NP_001917) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Defensins are a family of antimicrobial and cytotoxic peptides thought to be involved in host defense. They are abundant in the granules of neutrophils and also found in the epithelia of mucosal surfaces such as those of the intestine, respiratory tract, urinary tract, and vagina. Members of the defensin family are highly similar in protein sequence and distinguished by a conserved cysteine motif. Several alpha defensin genes appear to be clustered on chromosome 8. The protein encoded by this gene, defensin, alpha 6, is highly expressed in the secretory granules of Paneth cells of the small intestine, and likely plays a role in host defense of human bowel. |
Molecular Mass : | 11 kDa |
AA Sequence : | MRTLTILTAVLLVALQAKAEPLQAEDDPLQAKAYEADAQEQRGANDQDFAVSFAEDASSSLRALGSTRAFTCHCRRSCYSTEYSYGTCTVMGINHRFCCLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | DEFA6 defensin alpha 6 [ Homo sapiens (human) ] |
Official Symbol | DEFA6 |
Synonyms | DEFA6; defensin, alpha 6, Paneth cell-specific; defensin-6; DEF6; HD 6; defensin 6; HD-6; |
Gene ID | 1671 |
mRNA Refseq | NM_001926 |
Protein Refseq | NP_001917 |
MIM | 600471 |
UniProt ID | Q01524 |
◆ Recombinant Proteins | ||
DEFA6-122HF | Recombinant Full Length Human DEFA6 Protein | +Inquiry |
DEFA6-2429HF | Recombinant Full Length Human DEFA6 Protein, GST-tagged | +Inquiry |
DEFA6-1944H | Recombinant Human DEFA6 Protein (Ala19-Cys99), N-GST tagged | +Inquiry |
DEFA6-26996TH | Recombinant Human DEFA6 | +Inquiry |
DEFA6-451H | Recombinant Human DEFA6 Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DEFA6-6990HCL | Recombinant Human DEFA6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DEFA6 Products
Required fields are marked with *
My Review for All DEFA6 Products
Required fields are marked with *