Recombinant Human DEFA6 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : DEFA6-4854H
Product Overview : DEFA6 MS Standard C13 and N15-labeled recombinant protein (NP_001917) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : Defensins are a family of antimicrobial and cytotoxic peptides thought to be involved in host defense. They are abundant in the granules of neutrophils and also found in the epithelia of mucosal surfaces such as those of the intestine, respiratory tract, urinary tract, and vagina. Members of the defensin family are highly similar in protein sequence and distinguished by a conserved cysteine motif. Several alpha defensin genes appear to be clustered on chromosome 8. The protein encoded by this gene, defensin, alpha 6, is highly expressed in the secretory granules of Paneth cells of the small intestine, and likely plays a role in host defense of human bowel.
Molecular Mass : 11 kDa
AA Sequence : MRTLTILTAVLLVALQAKAEPLQAEDDPLQAKAYEADAQEQRGANDQDFAVSFAEDASSSLRALGSTRAFTCHCRRSCYSTEYSYGTCTVMGINHRFCCLTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name DEFA6 defensin alpha 6 [ Homo sapiens (human) ]
Official Symbol DEFA6
Synonyms DEFA6; defensin, alpha 6, Paneth cell-specific; defensin-6; DEF6; HD 6; defensin 6; HD-6;
Gene ID 1671
mRNA Refseq NM_001926
Protein Refseq NP_001917
MIM 600471
UniProt ID Q01524

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DEFA6 Products

Required fields are marked with *

My Review for All DEFA6 Products

Required fields are marked with *

0
cart-icon
0
compare icon