Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at AACR Annual Meeting|Apr. 5-10, 2024|Booth #2953

Recombinant Human DLG4

Cat.No. : DLG4-31002TH
Product Overview : Recombinant fragment corresponding to amino acids 665-766 of Human PSD95 isoform 2 with a N terminal proprietary tag; predicted MWt 36.85 kDa inclusive of tag
  • Specification
  • Gene Information
  • Related Products
Description : This gene encodes a member of the membrane-associated guanylate kinase (MAGUK) family. It heteromultimerizes with another MAGUK protein, DLG2, and is recruited into NMDA receptor and potassium channel clusters. These two MAGUK proteins may interact at postsynaptic sites to form a multimeric scaffold for the clustering of receptors, ion channels, and associated signaling proteins. Multiple transcript variants encoding different isoforms have been found for this gene.
Protein length : 102 amino acids
Molecular Weight : 36.850kDa inclusive of tags
Source : Wheat germ
Tissue specificity : Brain.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : QGKHCILDVSANAVRRLQAAHLHPIAIFIRPRSLENVLEI NKRITEEQARKAFDRATKLEQEFTECFSAIVEGDSFEEIY HKVKRVIEDLSGPYIWVPARER
Sequence Similarities : Belongs to the MAGUK family.Contains 1 guanylate kinase-like domain.Contains 3 PDZ (DHR) domains.Contains 1 SH3 domain.
Gene Name : DLG4 discs, large homolog 4 (Drosophila) [ Homo sapiens ]
Official Symbol : DLG4
Synonyms : DLG4; discs, large homolog 4 (Drosophila); disks large homolog 4; PSD 95; PSD95; SAP 90; SAP90;
Gene ID : 1742
mRNA Refseq : NM_001128827
Protein Refseq : NP_001122299
MIM : 602887
Uniprot ID : P78352
Chromosome Location : 17p13.1
Pathway : Activation of Ca-permeable Kainate Receptor, organism-specific biosystem; Activation of Kainate Receptors upon glutamate binding, organism-specific biosystem; Activation of NMDA receptor upon glutamate binding and postsynaptic events, organism-specific biosystem; Axon guidance, organism-specific biosystem; CREB phosphorylation through the activation of CaMKII, organism-specific biosystem;
Function : protein C-terminus binding; protein binding; scaffold protein binding;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends