"DNM2" Related Products

Expand
Expand

Recombinant Human DNM2, His-tagged

Cat.No.: DNM2-26990TH
Product Overview: Recombinant fragment, corresponding to amino acids 529-824 of Human Dynamin 2 with N terminal His tag. MWt 34kDa;
Description: Dynamins represent one of the subfamilies of GTP-binding proteins. These proteins share considerable sequence similarity over the N-terminal portion of the molecule, which contains the GTPase domain. Dynamins are associated with microtubules. They have been implicated in cell processes such as endocytosis and cell motility, and in alterations of the membrane that accompany certain activities such as bone resorption by osteoclasts. Dynamins bind many proteins that bind actin and other cytoskeletal proteins. Dynamins can also self-assemble, a process that stimulates GTPase activity. Five alternatively spliced transcripts encoding different proteins have been described. Additional alternatively spliced transcripts may exist, but their full-length nature has not been determined.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:Reconstitution with 104 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: (Amino acid sequence (Sequence determined by 5 Sequencing))LMKGGSKEYWFVLTAESLSWYKDEEE KEKKYMLPLDNLKIRDVEKGFMSNKHVFAIFNTEQRNV YKDLRQIELACDSQEDVDSWKASFLRAGVYPEKDQAENEDGAQENTFSMDPQLERQVETIRNLVDSYVAIINKSIRDL MPKTIMHLMINNTKAFIHHELLAYLYSSADQSSLMEES ADQAQRRDDMLRMYHALKEALNIIGDISTSTVSTPVPP PVDDTWLQSASSHSPTPQRRPVSSIHPPGRPPAVRGPTPG PPLIPVPVGAAASFSAPPIPSRPGPQSVFANSDLFPAP
Gene Name: DNM2 dynamin 2 [ Homo sapiens ]
Official Symbol: DNM2
Synonyms: DNM2; dynamin 2; dynamin-2; CMTDI1; CMTDIB; cytoskeletal protein; DI CMTB; DYN2; dynamin II; DYNII;
Gene ID: 1785
mRNA Refseq: NM_001005360
Protein Refseq: NP_001005360
MIM: 602378
Uniprot ID: P50570
Chromosome Location: 19p
Pathway: Arf6 trafficking events, organism-specific biosystem; Axon guidance, organism-specific biosystem; Bacterial invasion of epithelial cells, organism-specific biosystem; Bacterial invasion of epithelial cells, conserved biosystem; Clathrin derived vesicle budding, organism-specific biosystem;
Function: GTP binding; GTPase activity; GTPase activity; enzyme binding; hydrolase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.