Recombinant Human EIF4EBP2, His-tagged

Cat.No. : EIF4EBP2-28493TH
Product Overview : Recombinant full length Human eIF4EBP2 with a N terminal His tag; 140aa, 15.1kDa inclusive of tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 120 amino acids
Description : This gene encodes a member of the eukaryotic translation initiation factor 4E binding protein family. The gene products of this family bind eIF4E and inhibit translation initiation. However, insulin and other growth factors can release this inhibition via a phosphorylation-dependent disruption of their binding to eIF4E. Regulation of protein production through these gene products have been implicated in cell proliferation, cell differentiation and viral infection.
Conjugation : HIS
Molecular Weight : 15.100kDa inclusive of tags
Form : Liquid
Purity : by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0
Storage : Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMSSSAGSGHQPSQSRAIPTRTVAISDAAQLPHDYCTTPGGTLFSTTPGGTRIIYDRKFLLDRRNSPMAQTPPCHLPNIPGVTSPGTLIEDSKVEVNNLNNLNNHDRKHAVGDDAQFEMDI
Sequence Similarities : Belongs to the eIF4E-binding protein family.
Gene Name EIF4EBP2 eukaryotic translation initiation factor 4E binding protein 2 [ Homo sapiens ]
Official Symbol EIF4EBP2
Synonyms EIF4EBP2; eukaryotic translation initiation factor 4E binding protein 2; eukaryotic translation initiation factor 4E-binding protein 2;
Gene ID 1979
mRNA Refseq NM_004096
Protein Refseq NP_004087
MIM 602224
Uniprot ID Q13542
Chromosome Location 10q21-q22
Pathway Translation Factors, organism-specific biosystem;
Function eukaryotic initiation factor 4E binding; protein binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All EIF4EBP2 Products

Required fields are marked with *

My Review for All EIF4EBP2 Products

Required fields are marked with *

0
cart-icon