"EIF4EBP2" Related Products

Expand
Expand

Recombinant Human EIF4EBP2, His-tagged

Cat.No. : EIF4EBP2-28493TH
Product Overview : Recombinant full length Human eIF4EBP2 with a N terminal His tag; 140aa, 15.1kDa inclusive of tag.
Description : This gene encodes a member of the eukaryotic translation initiation factor 4E binding protein family. The gene products of this family bind eIF4E and inhibit translation initiation. However, insulin and other growth factors can release this inhibition via a phosphorylation-dependent disruption of their binding to eIF4E. Regulation of protein production through these gene products have been implicated in cell proliferation, cell differentiation and viral infection.
Protein length : 120 amino acids
Conjugation : HIS
Molecular Weight : 15.100kDa inclusive of tags
Source : E. coli
Form : Liquid
Purity : by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0
Storage : Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMSSSAGSGHQPSQSRAIPTRTVAISDAAQLPHDYCTTPGGTLFSTTPGGTRIIYDRKFLLDRRNSPMAQTPPCHLPNIPGVTSPGTLIEDSKVEVNNLNNLNNHDRKHAVGDDAQFEMDI
Sequence Similarities : Belongs to the eIF4E-binding protein family.
Gene Name : EIF4EBP2 eukaryotic translation initiation factor 4E binding protein 2 [ Homo sapiens ]
Official Symbol : EIF4EBP2
Synonyms : EIF4EBP2; eukaryotic translation initiation factor 4E binding protein 2; eukaryotic translation initiation factor 4E-binding protein 2;
Gene ID : 1979
mRNA Refseq : NM_004096
Protein Refseq : NP_004087
MIM : 602224
Uniprot ID : Q13542
Chromosome Location : 10q21-q22
Pathway : Translation Factors, organism-specific biosystem;
Function : eukaryotic initiation factor 4E binding; protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.