"EPOR" Related Products

Expand
Expand

Recombinant Human EPOR, Fc-tagged

Cat.No.: EPOR-27012TH
Product Overview: Recombinant fragment, corresponding to extracellular domain amino acids 25-250 of Human EPO Receptor fused to the Fc region of Human IgG1 (aa 93-330). The chimeric protein was expressed in modified human 293 cells.
Description: This gene encodes the erythropoietin receptor which is a member of the cytokine receptor family. Upon erythropoietin binding, this receptor activates Jak2 tyrosine kinase which activates different intracellular pathways including: Ras/MAP kinase, phosphatidylinositol 3-kinase and STAT transcription factors. The stimulated erythropoietin receptor appears to have a role in erythroid cell survival. Defects in the erythropoietin receptor may produce erythroleukemia and familial erythrocytosis. Dysregulation of this gene may affect the growth of certain tumors. Alternate splicing results in multiple transcript variants.
Conjugation: Fc
Tissue specificity: Erythroid cells and erythroid progenitor cells. Isoform EPOR-F is the most abundant form in EPO-dependent erythroleukemia cells and in late-stage erythroid progenitors. Isoform EPOR-S and isoform EPOR-T are the predominant forms in bone marrow. Isoform EP
Biological activity: The ED50 of EPOR-27012TH is typically 0.15-2.5 ng/ml as measured by its ability to neutralize EPO-mediated proliferation of TF-1 cells.
Form: Lyophilised:It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial.Following reconstitution, short-term storage at 4°C is recommended, and longer-term storage of aliquots at -18 to -20°C. Repeated freeze thawing is not rec
Purity: >95% by SDS-PAGE
Storage buffer: Preservative: NoneConstituents: 10% Trehalose, 1% Human serum albumin
Storage: Store at +4°C.
Sequences of amino acids: Theoretical sequence:APPPNLPDPKFESKAALLAARGPEELLCF TERLEDLVCFWEEAASAGVGPGNYSFSYQLEDEPWKLC RLHQAPTARGAVRFWCSLPTADTSSFVPLELRVTAASG APRYHRVIHINEVVLLDAPVGLVARLADESGHVVLRWLPPPETPMTSHIRYEVDVSAGNGAGSVQRVEILEGRTECVL SNLRGRTRYTFAVRARMAEPSFGGFWSAWSEPVSLLTP SDLDPRIPKVDKKVEPKSCDKTHTCPPCPAPELLGGPS VFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNW YVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCRVSNKALPAPIEKTISKAKGQPREPQVYTLPPSR DELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKT TPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEA LHNHYTQKSLSLSPGK
Sequence Similarities: Belongs to the type I cytokine receptor family. Type 1 subfamily.Contains 1 fibronectin type-III domain.
Gene Name: EPOR erythropoietin receptor [ Homo sapiens ]
Official Symbol: EPOR
Synonyms: EPOR; erythropoietin receptor;
Gene ID: 2057
mRNA Refseq: NM_000121
Protein Refseq: NP_000112
MIM: 133171
Uniprot ID: P19235
Chromosome Location: 19p13.3-p13.2
Pathway: Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; EPO Receptor Signaling, organism-specific biosystem; EPO signaling pathway, organism-specific biosystem; Hematopoietic cell lineage, organism-specific biosystem;
Function: erythropoietin receptor activity; identical protein binding; protein binding; receptor activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.