Recombinant Mouse Epor protein, His-tagged

Cat.No. : Epor-4534M
Product Overview : Recombinant Mouse Epor protein(P14753)(25-249 aa), fused with C-terminal His tag, was expressed in Mammalian Cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : Mammalian Cells
Tag : His
Protein Length : 25-249 aa
Form : For liquid formulations, the standard storage buffer consists of a Tris or PBS based solution supplemented with 5-50% glycerol. When provided as lyophilized powder, the product undergoes freeze-drying from a Tris- or PBS-based formulation containing 6% trehalose, adjusted to pH 8.0 prior to the lyophilization process.
Molecular Mass : 27.5 kDa
AASequence : APSPSLPDPKFESKAALLASRGSEELLCFTQRLEDLVCFWEEAASSGMDFNYSFSYQLEGESRKSCSLHQAPTVRGSVRFWCSLPTADTSSFVPLELQVTEASGSPRYHRIIHINEVVLLDAPAGLLARRAEEGSHVVLRWLPPPGAPMTTHIRYEVDVSAGNRAGGTQRVEVLEGRTECVLSNLRGGTRYTFAVRARMAEPSFSGFWSAWSEPASLLTASDLDP
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C.
Gene Name Epor erythropoietin receptor [ Mus musculus ]
Official Symbol Epor
Synonyms EPOR; erythropoietin receptor; EPO-R;
Gene ID 13857
mRNA Refseq NM_010149
Protein Refseq NP_034279

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Epor Products

Required fields are marked with *

My Review for All Epor Products

Required fields are marked with *

0
cart-icon