Recombinant Mouse Epor protein, His-tagged
| Cat.No. : | Epor-4534M |
| Product Overview : | Recombinant Mouse Epor protein(P14753)(25-249 aa), fused with C-terminal His tag, was expressed in Mammalian Cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | Mammalian Cells |
| Tag : | His |
| Protein Length : | 25-249 aa |
| Form : | For liquid formulations, the standard storage buffer consists of a Tris or PBS based solution supplemented with 5-50% glycerol. When provided as lyophilized powder, the product undergoes freeze-drying from a Tris- or PBS-based formulation containing 6% trehalose, adjusted to pH 8.0 prior to the lyophilization process. |
| Molecular Mass : | 27.5 kDa |
| AASequence : | APSPSLPDPKFESKAALLASRGSEELLCFTQRLEDLVCFWEEAASSGMDFNYSFSYQLEGESRKSCSLHQAPTVRGSVRFWCSLPTADTSSFVPLELQVTEASGSPRYHRIIHINEVVLLDAPAGLLARRAEEGSHVVLRWLPPPGAPMTTHIRYEVDVSAGNRAGGTQRVEVLEGRTECVLSNLRGGTRYTFAVRARMAEPSFSGFWSAWSEPASLLTASDLDP |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C. |
| Gene Name | Epor erythropoietin receptor [ Mus musculus ] |
| Official Symbol | Epor |
| Synonyms | EPOR; erythropoietin receptor; EPO-R; |
| Gene ID | 13857 |
| mRNA Refseq | NM_010149 |
| Protein Refseq | NP_034279 |
| ◆ Recombinant Proteins | ||
| EPOR-241H | Recombinant Human EPOR Protein, Fc-tagged | +Inquiry |
| EPOR-2045H | Recombinant Human EPOR Protein, Fc/His-tagged | +Inquiry |
| EPOR-3852Z | Recombinant Zebrafish EPOR | +Inquiry |
| EPOR-194H | Recombinant Human EPOR protein, His-tagged | +Inquiry |
| Epor-1100R | Recombinant Rat Epor protein, His-GB1&His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| EPOR-2055HCL | Recombinant Human EPOR cell lysate | +Inquiry |
| EPOR-2582MCL | Recombinant Mouse EPOR cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Epor Products
Required fields are marked with *
My Review for All Epor Products
Required fields are marked with *



