Recombinant Mouse Epor protein, His-tagged

• Cat.No.: Epor-4534M
• Product Overview: Recombinant Mouse Epor protein(P14753)(25-249 aa), fused with C-terminal His tag, was expressed in Mammalian Cells.

Specification

• Species: Mouse
• Source: Mammalian Cells
• Tag: His
• Protein Length: 25-249 aa
• Form: For liquid formulations, the standard storage buffer consists of a Tris or PBS based solution supplemented with 5-50% glycerol. When provided as lyophilized powder, the product undergoes freeze-drying from a Tris- or PBS-based formulation containing 6% trehalose, adjusted to pH 8.0 prior to the lyophilization process.
• Molecular Mass: 27.5 kDa
• AASequence: APSPSLPDPKFESKAALLASRGSEELLCFTQRLEDLVCFWEEAASSGMDFNYSFSYQLEGESRKSCSLHQAPTVRGSVRFWCSLPTADTSSFVPLELQVTEASGSPRYHRIIHINEVVLLDAPAGLLARRAEEGSHVVLRWLPPPGAPMTTHIRYEVDVSAGNRAGGTQRVEVLEGRTECVLSNLRGGTRYTFAVRARMAEPSFSGFWSAWSEPASLLTASDLDP
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C.

Gene Information

• Gene Name: Epor erythropoietin receptor [ Mus musculus ]
• Official Symbol: Epor
• Synonyms: EPOR; erythropoietin receptor; EPO-R
• Gene ID: 13857
• mRNA Refseq: NM_010149
• Protein Refseq: NP_034279