"EZR" Related Products

Expand
Expand

Recombinant Human EZR, His-tagged

Cat.No.: EZR-26818TH
Product Overview: Recombinant fragment, corresponding to amino acids 138-586 of Human Ezrin with N terminal His tag; Predicted MWt 55kDa.
Description: The cytoplasmic peripheral membrane protein encoded by this gene functions as a protein-tyrosine kinase substrate in microvilli. As a member of the ERM protein family, this protein serves as an intermediate between the plasma membrane and the actin cytoskeleton. This protein plays a key role in cell surface structure adhesion, migration and organization, and it has been implicated in various human cancers. A pseudogene located on chromosome 3 has been identified for this gene. Alternatively spliced variants have also been described for this gene.
Conjugation: HIS
Source: E. coli
Tissue specificity: Expressed in cerebral cortex, basal ganglia, hippocampus, hypophysis, and optic nerve. Weakly expressed in brain stem and diencephalon. Stronger expression was detected in gray matter of frontal lobe compared to white matter (at protein level). Component
Form: Lyophilised:Reconstitute with 74 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: NKEVHKSGYLSSERLIPQRVMDQHKLTRDQWEDRIQVWHA EHRGMLKDNAMLEYLKIAQDLEMYGINYFEIKNKKGTD LWLGVDALGLNIYEKDDKLTPKIGFPWSEIRNISFNDK KFVIKPIDKKAPDFVFYAPRLRINKRILQLCMGNHELY MRRRKPDTIEVQQMKAQAREEKHQKQLERQQLETEKKR RETVEREKEQMMREKEELMLRLQDYEEKTKKAERELSEQI QRALQLEEERKRAQEEAERLEADRMAALRAKEELERQA VDQIKSQEQLAAELAEYTAKIALLEEARRRKEDEVEEW QHRAKEAQDDLVKTKEELHLVMTAPPPPPPPVYEPVSY HVQESLQDEGAEPTGYSAELSSEGIRDDRNEEKRITEA EKNERVQRQLLTLSSELSQARDENKRTHNDIIHNENMRQGRDKYKTLRQIRQGNTKQRIDEFEAL
Sequence Similarities: Contains 1 FERM domain.
Gene Name: EZR ezrin [ Homo sapiens ]
Official Symbol: EZR
Synonyms: EZR; ezrin; VIL2, villin 2 (ezrin); cytovillin 2;
Gene ID: 7430
mRNA Refseq: NM_001111077
Protein Refseq: NP_001104547
MIM: 123900
Uniprot ID: P15311
Chromosome Location: 6q25.3
Pathway: Axon guidance, organism-specific biosystem; Developmental Biology, organism-specific biosystem; FAS (CD95) signaling pathway, organism-specific biosystem; Gastric acid secretion, organism-specific biosystem; Gastric acid secretion, conserved biosystem;
Function: actin filament binding; cell adhesion molecule binding; cytoskeletal protein binding; protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.