Recombinant Human EZR, His-tagged
Cat.No. : | EZR-26818TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 138-586 of Human Ezrin with N terminal His tag; Predicted MWt 55kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 138-586 a.a. |
Description : | The cytoplasmic peripheral membrane protein encoded by this gene functions as a protein-tyrosine kinase substrate in microvilli. As a member of the ERM protein family, this protein serves as an intermediate between the plasma membrane and the actin cytoskeleton. This protein plays a key role in cell surface structure adhesion, migration and organization, and it has been implicated in various human cancers. A pseudogene located on chromosome 3 has been identified for this gene. Alternatively spliced variants have also been described for this gene. |
Conjugation : | HIS |
Tissue specificity : | Expressed in cerebral cortex, basal ganglia, hippocampus, hypophysis, and optic nerve. Weakly expressed in brain stem and diencephalon. Stronger expression was detected in gray matter of frontal lobe compared to white matter (at protein level). Component |
Form : | Lyophilised:Reconstitute with 74 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | NKEVHKSGYLSSERLIPQRVMDQHKLTRDQWEDRIQVWHA EHRGMLKDNAMLEYLKIAQDLEMYGINYFEIKNKKGTD LWLGVDALGLNIYEKDDKLTPKIGFPWSEIRNISFNDK KFVIKPIDKKAPDFVFYAPRLRINKRILQLCMGNHELY MRRRKPDTIEVQQMKAQAREEKHQKQLERQQLETEKKR RETVEREKEQMMREKEELMLRLQDYEEKTKKAERELSEQI QRALQLEEERKRAQEEAERLEADRMAALRAKEELERQA VDQIKSQEQLAAELAEYTAKIALLEEARRRKEDEVEEW QHRAKEAQDDLVKTKEELHLVMTAPPPPPPPVYEPVSY HVQESLQDEGAEPTGYSAELSSEGIRDDRNEEKRITEA EKNERVQRQLLTLSSELSQARDENKRTHNDIIHNENMRQGRDKYKTLRQIRQGNTKQRIDEFEAL |
Sequence Similarities : | Contains 1 FERM domain. |
Gene Name | EZR ezrin [ Homo sapiens ] |
Official Symbol | EZR |
Synonyms | EZR; ezrin; VIL2, villin 2 (ezrin); cytovillin 2; |
Gene ID | 7430 |
mRNA Refseq | NM_001111077 |
Protein Refseq | NP_001104547 |
MIM | 123900 |
Uniprot ID | P15311 |
Chromosome Location | 6q25.3 |
Pathway | Axon guidance, organism-specific biosystem; Developmental Biology, organism-specific biosystem; FAS (CD95) signaling pathway, organism-specific biosystem; Gastric acid secretion, organism-specific biosystem; Gastric acid secretion, conserved biosystem; |
Function | actin filament binding; cell adhesion molecule binding; cytoskeletal protein binding; protein binding; |
◆ Recombinant Proteins | ||
EZR-5402M | Recombinant Mouse EZR Protein | +Inquiry |
EZR-1830R | Recombinant Rat EZR Protein, His (Fc)-Avi-tagged | +Inquiry |
EZR-1884H | Recombinant Human EZR Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
EZR-6677H | Recombinant Human EZR protein, His-tagged | +Inquiry |
EZR-2913M | Recombinant Mouse EZR Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EZR-6486HCL | Recombinant Human EZR 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All EZR Products
Required fields are marked with *
My Review for All EZR Products
Required fields are marked with *
0
Inquiry Basket