Recombinant Human EZR Protein (1-251 aa), His-SUMO-tagged

Cat.No. : EZR-492H
Product Overview : Recombinant Human EZR Protein (1-251 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Cell Cycle. Protein Description: Partial.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&SUMO
Protein Length : 1-251 aa
Description : Probably involved in connections of major cytoskeletal structures to the plasma mbrane. In epithelial cells, required for the formation of microvilli and mbrane ruffles on the apical pole. Along with PLEKHG6, required for normal macropinocytosis.
Form : Tris-based buffer, 50% glycerol
Molecular Mass : 45.4 kDa
AA Sequence : MPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWYFGLHYVDNKGFPTWLKLDKKVSAQEVRKENPLQFKFRAKFYPEDVAEELIQDITQKLFFLQVKEGILSDEIYCPPETAVLLGSYAVQAKFGDYNKEVHKSGYLSSERLIPQRVMDQHKLTRDQWEDRIQVWHAEHRGMLKDNAMLEYLKIAQDLEMYGINYFEIKNKKGTDLWLGVDALGLNIYEKDDKLTPKIGFPWSEIRNISFN
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with concentration instruction is sent along with the products.
Gene Name EZR ezrin [ Homo sapiens ]
Official Symbol EZR
Synonyms EZR; ezrin; cytovillin 2; p81; villin-2; CVL; CVIL; VIL2; MGC1584; FLJ26216; DKFZp762H157;
Gene ID 7430
mRNA Refseq NM_001111077
Protein Refseq NP_001104547
MIM 123900
UniProt ID P15311

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All EZR Products

Required fields are marked with *

My Review for All EZR Products

Required fields are marked with *

0
cart-icon
0
compare icon