"FANCB" Related Products

Recombinant Human FANCB

Cat.No.: FANCB-27930TH
Product Overview: Recombinant fragment of Human FANCB with a N terminal proprietary tag; Predicted MW 37.65 kDa.
Description: The Fanconi anemia complementation group (FANC) currently includes FANCA, FANCB, FANCC, FANCD1 (also called BRCA2), FANCD2, FANCE, FANCF, FANCG, FANCI, FANCJ (also called BRIP1), FANCL, FANCM and FANCN (also called PALB2). The previously defined group FANCH is the same as FANCA. Fanconi anemia is a genetically heterogeneous recessive disorder characterized by cytogenetic instability, hypersensitivity to DNA crosslinking agents, increased chromosomal breakage, and defective DNA repair. The members of the Fanconi anemia complementation group do not share sequence similarity; they are related by their assembly into a common nuclear protein complex. This gene encodes the protein for complementation group B. Alternative splicing results in two transcript variants encoding the same protein.
Protein length: 109 amino acids
Molecular Weight: 37.620kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: GSENFLIDNMAFTLEKELVTLSSLSSAIAKHESNFMQRCE VSKGKSSVVAAALSDRRENIHPYRKELQREKKKMLQTNLK VSGALYREITLKVAEVQLKSDFAAQKLSN
Gene Name: FANCB Fanconi anemia, complementation group B [ Homo sapiens ]
Official Symbol: FANCB
Synonyms: FANCB; Fanconi anemia, complementation group B; Fanconi anemia group B protein; FAAP95; FAB; FLJ34064;
Gene ID: 2187
mRNA Refseq: NM_001018113
Protein Refseq: NP_001018123
MIM: 300515
Uniprot ID: Q8NB91
Chromosome Location: Xp22.2
Pathway: DNA Repair, organism-specific biosystem; FA core complex, organism-specific biosystem; Fanconi Anemia pathway, organism-specific biosystem; Fanconi anemia pathway, organism-specific biosystem; Fanconi anemia pathway, conserved biosystem;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.