"FASN" Related Products

Expand
Expand
Expand

Recombinant Human FASN, His-tagged

Cat.No.: FASN-28809TH
Product Overview: Recombinant fragment, corresponding to amino acids 2181-2502 of Human Fatty Acid Synthase with an N terminal His tag; MWt 37 kDa
Description: The enzyme encoded by this gene is a multifunctional protein. Its main function is to catalyze the synthesis of palmitate from acetyl-CoA and malonyl-CoA, in the presence of NADPH, into long-chain saturated fatty acids. In some cancer cell lines, this protein has been found to be fused with estrogen receptor-alpha (ER-alpha), in which the N-terminus of FAS is fused in-frame with the C-terminus of ER-alpha.
Conjugation: HIS
Source: E. coli
Tissue specificity: Ubiquitous. Prominent expression in brain, lung, and liver.
Form: Lyophilised:Reconstitute with 64 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: QLTLRKLQELSSKADEASELACPTPKEDGLAQQQTQLNLR SLLVNPEGPTLMRLNSVQSSERPLFLVHPIEGSTTVFH SLASRLSIPTYGLQCTRAAPLDSIHSLAAYYIDCIRQV QPEGPYRVAGYSYGACVAFEMCSQLQAQQSPAPTHNSL FLFDGSPTYVLAYTQSYRAKLTPGCEAEAETEAICFFVQQFTDMEHNRVLEALLPLKGLEERVAAAVDLIIKSHQGLD RQELSFAARSFYYKLRAAEQYTPKAKYHGNVMLLRAKT GGAYGEDLGADYNLSQVCDGKVSVHVIEGDHRTLLEGS GLESIISIIHSSLA
Sequence Similarities: Contains 1 acyl carrier domain.
Gene Name: FASN fatty acid synthase [ Homo sapiens ]
Official Symbol: FASN
Synonyms: FASN; fatty acid synthase; FAS; SDR27X1; short chain dehydrogenase/reductase family 27X; member 1;
Gene ID: 2194
mRNA Refseq: NM_004104
Protein Refseq: NP_004095
MIM: 600212
Uniprot ID: P49327
Chromosome Location: 17q25
Pathway: ChREBP activates metabolic gene expression, organism-specific biosystem; Fatty Acid Biosynthesis, organism-specific biosystem; Fatty Acyl-CoA Biosynthesis, organism-specific biosystem; Fatty acid biosynthesis, organism-specific biosystem; Fatty acid biosynthesis, conserved biosystem;
Function: 3-hydroxypalmitoyl-[acyl-carrier-protein] dehydratase activity; 3-oxoacyl-[acyl-carrier-protein] reductase (NADPH) activity; 3-oxoacyl-[acyl-carrier-protein] synthase activity; [acyl-carrier-protein] S-acetyltransferase activity; [acyl-carrier-protein] S-;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.