Recombinant Human FASN, His-tagged FASN-28809TH

Recombinant Human FASN, His-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human FASN, His-tagged

Recombinant Human FASN, His-tagged

FASN Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : FASN-28809TH
Product Overview : Recombinant fragment, corresponding to amino acids 2181-2502 of Human Fatty Acid Synthase with an N terminal His tag; MWt 37 kDa
Description : The enzyme encoded by this gene is a multifunctional protein. Its main function is to catalyze the synthesis of palmitate from acetyl-CoA and malonyl-CoA, in the presence of NADPH, into long-chain saturated fatty acids. In some cancer cell lines, this protein has been found to be fused with estrogen receptor-alpha (ER-alpha), in which the N-terminus of FAS is fused in-frame with the C-terminus of ER-alpha.
Conjugation : HIS
Source : E. coli
Tissue specificity : Ubiquitous. Prominent expression in brain, lung, and liver.
Form : Lyophilised:Reconstitute with 64 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : QLTLRKLQELSSKADEASELACPTPKEDGLAQQQTQLNLR SLLVNPEGPTLMRLNSVQSSERPLFLVHPIEGSTTVFH SLASRLSIPTYGLQCTRAAPLDSIHSLAAYYIDCIRQV QPEGPYRVAGYSYGACVAFEMCSQLQAQQSPAPTHNSL FLFDGSPTYVLAYTQSYRAKLTPGCEAEAETEAICFFVQQFTDMEHNRVLEALLPLKGLEERVAAAVDLIIKSHQGLD RQELSFAARSFYYKLRAAEQYTPKAKYHGNVMLLRAKT GGAYGEDLGADYNLSQVCDGKVSVHVIEGDHRTLLEGS GLESIISIIHSSLA
Sequence Similarities : Contains 1 acyl carrier domain.
Gene Name : FASN fatty acid synthase [ Homo sapiens ]
Official Symbol : FASN
Synonyms : FASN; fatty acid synthase; FAS; SDR27X1; short chain dehydrogenase/reductase family 27X; member 1;
Gene ID : 2194
mRNA Refseq : NM_004104
Protein Refseq : NP_004095
MIM : 600212
Uniprot ID : P49327
Chromosome Location : 17q25
Pathway : ChREBP activates metabolic gene expression, organism-specific biosystem; Fatty Acid Biosynthesis, organism-specific biosystem; Fatty Acyl-CoA Biosynthesis, organism-specific biosystem; Fatty acid biosynthesis, organism-specific biosystem; Fatty acid biosynthesis, conserved biosystem;
Function : 3-hydroxypalmitoyl-[acyl-carrier-protein] dehydratase activity; 3-oxoacyl-[acyl-carrier-protein] reductase (NADPH) activity; 3-oxoacyl-[acyl-carrier-protein] synthase activity; [acyl-carrier-protein] S-acetyltransferase activity; [acyl-carrier-protein] S-;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy