"GCSH" Related Products

Expand
Expand
Expand

Recombinant Human GCSH, His-tagged

Cat.No.: GCSH-27469TH
Product Overview: Recombinant full length Human GCSH with N terminal His tag; 149 amino acids with tag, Predicted MWt 16.4 kDa.
Description: Degradation of glycine is brought about by the glycine cleavage system, which is composed of four mitochondrial protein components: P protein (a pyridoxal phosphate-dependent glycine decarboxylase), H protein (a lipoic acid-containing protein), T protein (a tetrahydrofolate-requiring enzyme), and L protein (a lipoamide dehydrogenase). The protein encoded by this gene is the H protein, which transfers the methylamine group of glycine from the P protein to the T protein. Defects in this gene are a cause of nonketotic hyperglycinemia (NKH). Two transcript variants, one protein-coding and the other probably not protein-coding,have been found for this gene. Also, several transcribed and non-transcribed pseudogenes of this gene exist throughout the genome.
Protein length: 125 amino acids
Conjugation: HIS
Molecular Weight: 16.400kDa inclusive of tags
Source: E. coli
Form: Liquid
Purity: >95% by SDS-PAGE
Storage buffer: pH: 8.00Constituents:0.32% Tris HCl, 10% Glycerol, 0.02% DTT, 0.88% Sodium chloride
Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMGSMSVRKFTEKHEWVTTENGIGTVGISNFAQEALGDVVYCSLPEVGTKLNKQDEFGALESVKAASELYSPLSGEVTEINEALAENPGLVNKSCYEDGWLIKMTLSNPSELDELMSEEAYEKYIKSIEE
Sequence Similarities: Belongs to the gcvH family.Contains 1 lipoyl-binding domain.
Gene Name: GCSH glycine cleavage system protein H (aminomethyl carrier) [ Homo sapiens ]
Official Symbol: GCSH
Synonyms: GCSH; glycine cleavage system protein H (aminomethyl carrier); glycine cleavage system H protein, mitochondrial; lipoic acid containing protein;
Gene ID: 2653
mRNA Refseq: NM_004483
Protein Refseq: NP_004474
MIM: 238330
Uniprot ID: P23434
Chromosome Location: 16q23.2
Function: aminomethyltransferase activity; enzyme binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.