"GLUD2" Related Products

Recombinant Human GLUD2, His-tagged

Cat.No. : GLUD2-27654TH
Product Overview : Recombinant fragment, corresponding to amino acids 229-541 of Human GLUD2 with N terminal His tag; 313 amino acids, 36kDa.
Description : The protein encoded by this gene is localized to the mitochondrion and acts as a homohexamer to recycle glutamate during neurotransmission. The encoded enzyme catalyzes the reversible oxidative deamination of glutamate to alpha-ketoglutarate. This gene is intronless.
Conjugation : HIS
Source : E. coli
Form : Lyophilised:Reconstitute with 89 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Store at 4°C. Upon reconstitution store at -80oC.
Sequences of amino acids : GEREMSWIADTYASTIGHYDINAHACVTGKPISQGGIHGR ISATGRGVFHGIENFINEASYMSILGMTPGFRDKTFVV QGFGNVGLHSMRYLHRFGAKCIAVGESDGSIWNPDGIDPK ELEDFKLQHGSILGFPKAKPYEGSILEVDCDILIPAAT EKQLTKSNAPRVKAKIIAEGANGPTTPEADKIFLERNI LVIPDLYLNAGGVTVSYFEWLKNLNHVSYGRLTFKYERDS NYHLLLSVQESLERKFGKHGGTIPIVPTAEFQDSISGA SEKDIVHSALAYTMERSARQIMHTAMKYNLGLDLRTAAYVN
Gene Name : GLUD2 glutamate dehydrogenase 2 [ Homo sapiens ]
Official Symbol : GLUD2
Synonyms : GLUD2; glutamate dehydrogenase 2; GLUDP1, glutamate dehydrogenase pseudogene 1; glutamate dehydrogenase 2, mitochondrial;
Gene ID : 2747
mRNA Refseq : NM_012084
Protein Refseq : NP_036216
MIM : 300144
Uniprot ID : P49448
Chromosome Location : Xq24-q25
Pathway : Alanine, aspartate and glutamate metabolism, organism-specific biosystem; Alanine, aspartate and glutamate metabolism, conserved biosystem; Arginine and proline metabolism, organism-specific biosystem; Arginine and proline metabolism, conserved biosystem; D-Glutamine and D-glutamate metabolism, organism-specific biosystem;
Function : ADP binding; GTP binding; glutamate dehydrogenase (NAD+) activity; glutamate dehydrogenase [NAD(P)+] activity; leucine binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.