Recombinant Human GPX3, His-tagged
Cat.No. : | GPX3-29077TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 93-226 of Human Glutathione Peroxidase 3 with an N terminal His tag. Predicted MWt: 16 kDa; |
- Specification
- Gene Information
- Related Products
Description : | This gene product belongs to the glutathione peroxidase family, which functions in the detoxification of hydrogen peroxide. It contains a selenocysteine (Sec) residue at its active site. The selenocysteine is encoded by the UGA codon, which normally signals translation termination. The 3 UTR of Sec-containing genes have a common stem-loop structure, the sec insertion sequence (SECIS), which is necessary for the recognition of UGA as a Sec codon rather than as a stop signal. |
Conjugation : | HIS |
Source : | E. coli |
Tissue specificity : | Secreted in plasma. |
Form : | Lyophilised:Reconstitute with 88 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | GLVILGFPCNQFGKQEPGENSEILPTLKYVRPGGGFVPNF QLFEKGDVNGEKEQKFYTFLKNSCPPTSELLGTSDRLF WEPMKVHDIRWNFEKFLVGPDGIPIMRWHHRTTVSNVK MDILSYMRRQAALGVKRK |
Sequence Similarities : | Belongs to the glutathione peroxidase family. |
Gene Name : | GPX3 glutathione peroxidase 3 (plasma) [ Homo sapiens ] |
Official Symbol : | GPX3 |
Synonyms : | GPX3; glutathione peroxidase 3 (plasma); glutathione peroxidase 3; |
Gene ID : | 2878 |
mRNA Refseq : | NM_002084 |
Protein Refseq : | NP_002075 |
MIM : | 138321 |
Uniprot ID : | P22352 |
Chromosome Location : | 5q23 |
Pathway : | Arachidonic acid metabolism, organism-specific biosystem; Arachidonic acid metabolism, conserved biosystem; Folate Metabolism, organism-specific biosystem; Glutathione metabolism, organism-specific biosystem; Glutathione metabolism, organism-specific biosystem; |
Function : | glutathione binding; glutathione peroxidase activity; glutathione peroxidase activity; oxidoreductase activity; selenium binding; |
Products Types
◆ Recombinant Protein | ||
Gpx3-22M | Recombinant Mouse Gpx3 Protein | +Inquiry |
Gpx3-01M | Recombinant Mouse Gpx3 Protein, His-tagged | +Inquiry |
GPX3-3073H | Recombinant Human GPX3 Protein, His (Fc)-Avi-tagged | +Inquiry |
GPX3-3903M | Recombinant Mouse GPX3 Protein, His (Fc)-Avi-tagged | +Inquiry |
GPX3-953H | Recombinant Human GPX3 Protein, His-tagged | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket