"HLA-DMA" Related Products

Recombinant Human HLA-DMA

Cat.No.: HLA-DMA-27713TH
Product Overview: Recombinant full length Human HLA DM protein with an N terminal proprietary tag; Predicted MW 54.45 kDa.
Description: HLA-DMA belongs to the HLA class II alpha chain paralogues. This class II molecule is a heterodimer consisting of an alpha (DMA) and a beta chain (DMB), both anchored in the membrane. It is located in intracellular vesicles. DM plays a central role in the peptide loading of MHC class II molecules by helping to release the CLIP molecule from the peptide binding site. Class II molecules are expressed in antigen presenting cells (APC: B lymphocytes, dendritic cells, macrophages). The alpha chain is approximately 33-35 kDa and its gene contains 5 exons. Exon one encodes the leader peptide, exons 2 and 3 encode the two extracellular domains, exon 4 encodes the transmembrane domain and the cytoplasmic tail.
Protein length: 261 amino acids
Molecular Weight: 54.450kDa
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MGHEQNQGAALLQMLPLLWLLPHSWAVPEAPTPMWPDDLQ NHTFLHTVYCQDGSPSVGLSEAYDEDQLFFFDFSQNTRVP RLPEFADWAQEQGDAPAILFDKEFCEWMIQQIGPKLDGKI PVSRGFPIAEVFTLKPLEFGKPNTLVCFVSNLFPPMLTVN WQHHSVPVEGFGPTFVSAVDGLSFQAFSYLNFTPEPSDIF SCIVTHEIDRYTAIAYWVPRNALPSDLLENVLCGVAFGLG VLGIIVGIVLIIYFRKPCSGD
Gene Name: HLA-DMA major histocompatibility complex, class II, DM alpha [ Homo sapiens ]
Official Symbol: HLA-DMA
Synonyms: HLA-DMA; major histocompatibility complex, class II, DM alpha; HLA class II histocompatibility antigen, DM alpha chain; D6S222E; RING6;
Gene ID: 3108
mRNA Refseq: NM_006120
Protein Refseq: NP_006111
MIM: 142855
Uniprot ID: P28067
Chromosome Location: 6p21.3
Pathway: Adaptive Immune System, organism-specific biosystem; Allograft rejection, organism-specific biosystem; Allograft rejection, conserved biosystem; Antigen processing and presentation, organism-specific biosystem; Antigen processing and presentation, conserved biosystem;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.