Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at AACR Annual Meeting|Apr. 5-10, 2024|Booth #2953

Recombinant Human HLA-DMA

Cat.No. : HLA-DMA-27713TH
Product Overview : Recombinant full length Human HLA DM protein with an N terminal proprietary tag; Predicted MW 54.45 kDa.
  • Specification
  • Gene Information
  • Related Products
Description : HLA-DMA belongs to the HLA class II alpha chain paralogues. This class II molecule is a heterodimer consisting of an alpha (DMA) and a beta chain (DMB), both anchored in the membrane. It is located in intracellular vesicles. DM plays a central role in the peptide loading of MHC class II molecules by helping to release the CLIP molecule from the peptide binding site. Class II molecules are expressed in antigen presenting cells (APC: B lymphocytes, dendritic cells, macrophages). The alpha chain is approximately 33-35 kDa and its gene contains 5 exons. Exon one encodes the leader peptide, exons 2 and 3 encode the two extracellular domains, exon 4 encodes the transmembrane domain and the cytoplasmic tail.
Protein length : 261 amino acids
Molecular Weight : 54.450kDa
Source : Wheat germ
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MGHEQNQGAALLQMLPLLWLLPHSWAVPEAPTPMWPDDLQ NHTFLHTVYCQDGSPSVGLSEAYDEDQLFFFDFSQNTRVP RLPEFADWAQEQGDAPAILFDKEFCEWMIQQIGPKLDGKI PVSRGFPIAEVFTLKPLEFGKPNTLVCFVSNLFPPMLTVN WQHHSVPVEGFGPTFVSAVDGLSFQAFSYLNFTPEPSDIF SCIVTHEIDRYTAIAYWVPRNALPSDLLENVLCGVAFGLG VLGIIVGIVLIIYFRKPCSGD
Gene Name : HLA-DMA major histocompatibility complex, class II, DM alpha [ Homo sapiens ]
Official Symbol : HLA-DMA
Synonyms : HLA-DMA; major histocompatibility complex, class II, DM alpha; HLA class II histocompatibility antigen, DM alpha chain; D6S222E; RING6;
Gene ID : 3108
mRNA Refseq : NM_006120
Protein Refseq : NP_006111
MIM : 142855
Uniprot ID : P28067
Chromosome Location : 6p21.3
Pathway : Adaptive Immune System, organism-specific biosystem; Allograft rejection, organism-specific biosystem; Allograft rejection, conserved biosystem; Antigen processing and presentation, organism-specific biosystem; Antigen processing and presentation, conserved biosystem;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (5)

Ask a question
How does HLA-DMA relate to autoimmune diseases? 07/01/2020

Aberrant antigen presentation mediated by HLA-DMA has been implicated in autoimmune diseases, as it may lead to the presentation of self-antigens and the activation of autoreactive T cells.

How can HLA-DMA be a potential therapeutic target? 12/19/2019

Modulating HLA-DMA activity could be explored as a therapeutic strategy in conditions where immune dysregulation occurs, such as autoimmune diseases, by influencing antigen presentation.

How does HLA-DMA contribute to the adaptive immune response? 07/30/2018

HLA-DMA facilitates the loading of antigenic peptides onto MHC class II molecules, a process essential for the activation of CD4+ T cells and the adaptive immune response.

In transplantation, how does HLA-DMA impact graft acceptance or rejection? 11/10/2017

Understanding HLA-DMA's role is crucial in transplantation, as it affects the presentation of antigens from the graft, influencing the immune response and the likelihood of graft acceptance or rejection.

Are there genetic variations in HLA-DMA that can influence disease susceptibility? 09/18/2017

Genetic variations in the HLA-DMA gene may contribute to differences in antigen presentation and influence susceptibility to certain diseases, making it an area of interest in genetic studies.

Customer Reviews (3)

Write a review
Reviews
08/17/2021

    Their in-depth understanding of the protein's characteristics, applications, and potential limitations allows for valuable insights and recommendations, ensuring the success of my experiments.

    06/20/2016

      Its purity, integrity, and consistency ensure reliable and reproducible results, which are essential for meaningful scientific discoveries.

      04/04/2016

        Whether it's troubleshooting, protocol optimization, or general inquiries, their knowledgeable and responsive team is readily available to assist and solve any problems that may arise during the experimental process.

        Ask a Question for All HLA-DMA Products

        Required fields are marked with *

        My Review for All HLA-DMA Products

        Required fields are marked with *

        0

        Inquiry Basket

        cartIcon
        logo

        FOLLOW US

        Terms and Conditions        Privacy Policy

        Copyright © 2024 Creative BioMart. All Rights Reserved.

        Contact Us

        • /

        Stay Updated on the Latest Bioscience Trends