Recombinant Human HLA-DMA
Cat.No. : | HLA-DMA-27713TH |
Product Overview : | Recombinant full length Human HLA DM protein with an N terminal proprietary tag; Predicted MW 54.45 kDa. |
- Specification
- Gene Information
- Related Products
Description : | HLA-DMA belongs to the HLA class II alpha chain paralogues. This class II molecule is a heterodimer consisting of an alpha (DMA) and a beta chain (DMB), both anchored in the membrane. It is located in intracellular vesicles. DM plays a central role in the peptide loading of MHC class II molecules by helping to release the CLIP molecule from the peptide binding site. Class II molecules are expressed in antigen presenting cells (APC: B lymphocytes, dendritic cells, macrophages). The alpha chain is approximately 33-35 kDa and its gene contains 5 exons. Exon one encodes the leader peptide, exons 2 and 3 encode the two extracellular domains, exon 4 encodes the transmembrane domain and the cytoplasmic tail. |
Protein length : | 261 amino acids |
Molecular Weight : | 54.450kDa |
Source : | Wheat germ |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MGHEQNQGAALLQMLPLLWLLPHSWAVPEAPTPMWPDDLQ NHTFLHTVYCQDGSPSVGLSEAYDEDQLFFFDFSQNTRVP RLPEFADWAQEQGDAPAILFDKEFCEWMIQQIGPKLDGKI PVSRGFPIAEVFTLKPLEFGKPNTLVCFVSNLFPPMLTVN WQHHSVPVEGFGPTFVSAVDGLSFQAFSYLNFTPEPSDIF SCIVTHEIDRYTAIAYWVPRNALPSDLLENVLCGVAFGLG VLGIIVGIVLIIYFRKPCSGD |
Gene Name : | HLA-DMA major histocompatibility complex, class II, DM alpha [ Homo sapiens ] |
Official Symbol : | HLA-DMA |
Synonyms : | HLA-DMA; major histocompatibility complex, class II, DM alpha; HLA class II histocompatibility antigen, DM alpha chain; D6S222E; RING6; |
Gene ID : | 3108 |
mRNA Refseq : | NM_006120 |
Protein Refseq : | NP_006111 |
MIM : | 142855 |
Uniprot ID : | P28067 |
Chromosome Location : | 6p21.3 |
Pathway : | Adaptive Immune System, organism-specific biosystem; Allograft rejection, organism-specific biosystem; Allograft rejection, conserved biosystem; Antigen processing and presentation, organism-specific biosystem; Antigen processing and presentation, conserved biosystem; |
Products Types
◆ Recombinant Protein | ||
HLA-DMA-4836H | Recombinant Human HLA-DMA Protein, GST-tagged | +Inquiry |
HLA-DMA-13812H | Recombinant Human HLA-DMA, GST-tagged | +Inquiry |
HLA-DMA-4026H | Recombinant Human HLA-DMA protein, His-tagged | +Inquiry |
◆ Lysates | ||
HLA-DMA-5499HCL | Recombinant Human HLA 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (5)
Ask a questionAberrant antigen presentation mediated by HLA-DMA has been implicated in autoimmune diseases, as it may lead to the presentation of self-antigens and the activation of autoreactive T cells.
Modulating HLA-DMA activity could be explored as a therapeutic strategy in conditions where immune dysregulation occurs, such as autoimmune diseases, by influencing antigen presentation.
HLA-DMA facilitates the loading of antigenic peptides onto MHC class II molecules, a process essential for the activation of CD4+ T cells and the adaptive immune response.
Understanding HLA-DMA's role is crucial in transplantation, as it affects the presentation of antigens from the graft, influencing the immune response and the likelihood of graft acceptance or rejection.
Genetic variations in the HLA-DMA gene may contribute to differences in antigen presentation and influence susceptibility to certain diseases, making it an area of interest in genetic studies.
Customer Reviews (3)
Write a reviewTheir in-depth understanding of the protein's characteristics, applications, and potential limitations allows for valuable insights and recommendations, ensuring the success of my experiments.
Its purity, integrity, and consistency ensure reliable and reproducible results, which are essential for meaningful scientific discoveries.
Whether it's troubleshooting, protocol optimization, or general inquiries, their knowledgeable and responsive team is readily available to assist and solve any problems that may arise during the experimental process.
Ask a Question for All HLA-DMA Products
Required fields are marked with *
My Review for All HLA-DMA Products
Required fields are marked with *
Inquiry Basket