Recombinant Human HLA-DMA protein, His-tagged
Cat.No. : | HLA-DMA-4026H |
Product Overview : | Recombinant Human HLA-DMA protein(Q6ICR9)(27-233aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 27-233aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 27.4 kDa |
AA Sequence : | VPEAPTPMWPDDLQNHTFLHTVYCQDGSPSVGLSEAYDEDQLFFFDFSQNTRVPRLPEFADWAQEQGDAPAILFDKEFCEWMIQQIGPKLDGKIPVSRGFPIAEVFTLKPLEFGKPNTLVCFVSNLFPPMLTVNWQHHSVPVEGFGPTFVSAVDGLSFQAFSYLNFTPEPSDIFSCIVTHEIDRYTAIAYWVPRNALPSDLLENVLC |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | HLA-DMA major histocompatibility complex, class II, DM alpha [ Homo sapiens ] |
Official Symbol | HLA-DMA |
Synonyms | HLA-DMA; major histocompatibility complex, class II, DM alpha; HLA class II histocompatibility antigen, DM alpha chain; D6S222E; RING6; MHC class II antigen DMA; really interesting new gene 6 protein; class II histocompatibility antigen, M alpha chain; DMA; HLADM; |
Gene ID | 3108 |
mRNA Refseq | NM_006120 |
Protein Refseq | NP_006111 |
MIM | 142855 |
UniProt ID | P28067 |
◆ Recombinant Proteins | ||
HLA-DMA-230HF | Recombinant Full Length Human HLA-DMA Protein | +Inquiry |
HLA-DMA-4836H | Recombinant Human HLA-DMA Protein, GST-tagged | +Inquiry |
HLA-DMA-13812H | Recombinant Human HLA-DMA, GST-tagged | +Inquiry |
HLA-DMA-27713TH | Recombinant Human HLA-DMA | +Inquiry |
HLA-DMA-3561HF | Recombinant Full Length Human HLA-DMA Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HLA-DMA-5499HCL | Recombinant Human HLA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HLA-DMA Products
Required fields are marked with *
My Review for All HLA-DMA Products
Required fields are marked with *
0
Inquiry Basket