Recombinant Human HLA-DMA
Cat.No. : | HLA-DMA-27713TH |
Product Overview : | Recombinant full length Human HLA DM protein with an N terminal proprietary tag; Predicted MW 54.45 kDa. |
- Specification
- Gene Information
- Related Products
Description : | HLA-DMA belongs to the HLA class II alpha chain paralogues. This class II molecule is a heterodimer consisting of an alpha (DMA) and a beta chain (DMB), both anchored in the membrane. It is located in intracellular vesicles. DM plays a central role in the peptide loading of MHC class II molecules by helping to release the CLIP molecule from the peptide binding site. Class II molecules are expressed in antigen presenting cells (APC: B lymphocytes, dendritic cells, macrophages). The alpha chain is approximately 33-35 kDa and its gene contains 5 exons. Exon one encodes the leader peptide, exons 2 and 3 encode the two extracellular domains, exon 4 encodes the transmembrane domain and the cytoplasmic tail. |
Protein length : | 261 amino acids |
Molecular Weight : | 54.450kDa |
Source : | Wheat germ |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MGHEQNQGAALLQMLPLLWLLPHSWAVPEAPTPMWPDDLQ NHTFLHTVYCQDGSPSVGLSEAYDEDQLFFFDFSQNTRVP RLPEFADWAQEQGDAPAILFDKEFCEWMIQQIGPKLDGKI PVSRGFPIAEVFTLKPLEFGKPNTLVCFVSNLFPPMLTVN WQHHSVPVEGFGPTFVSAVDGLSFQAFSYLNFTPEPSDIF SCIVTHEIDRYTAIAYWVPRNALPSDLLENVLCGVAFGLG VLGIIVGIVLIIYFRKPCSGD |
Gene Name : | HLA-DMA major histocompatibility complex, class II, DM alpha [ Homo sapiens ] |
Official Symbol : | HLA-DMA |
Synonyms : | HLA-DMA; major histocompatibility complex, class II, DM alpha; HLA class II histocompatibility antigen, DM alpha chain; D6S222E; RING6; |
Gene ID : | 3108 |
mRNA Refseq : | NM_006120 |
Protein Refseq : | NP_006111 |
MIM : | 142855 |
Uniprot ID : | P28067 |
Chromosome Location : | 6p21.3 |
Pathway : | Adaptive Immune System, organism-specific biosystem; Allograft rejection, organism-specific biosystem; Allograft rejection, conserved biosystem; Antigen processing and presentation, organism-specific biosystem; Antigen processing and presentation, conserved biosystem; |
Products Types
◆ Recombinant Protein | ||
HLA-DMA-4836H | Recombinant Human HLA-DMA Protein, GST-tagged | +Inquiry |
HLA-DMA-13812H | Recombinant Human HLA-DMA, GST-tagged | +Inquiry |
HLA-DMA-4026H | Recombinant Human HLA-DMA protein, His-tagged | +Inquiry |
◆ Lysates | ||
HLA-DMA-5499HCL | Recombinant Human HLA 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket