"HTR5A" Related Products

Expand
Expand
Expand

Recombinant Human HTR5A

Cat.No.: HTR5A-26029TH
Product Overview: Recombinant full length Human 5HT5A receptor (aa 1-357) with N terminal proprietary tag, 65.34 kDa.
Description: The neurotransmitter serotonin (5-hydroxytryptamine, 5-HT) has been implicated in a wide range of psychiatric conditions and also has vasoconstrictive and vasodilatory effects. The gene described in this record is a member of 5-hydroxytryptamine (serotonin) receptor family and encodes a multi-pass membrane protein that functions as a receptor for 5-hydroxytryptamine and couples to G-proteins. This protein has been shown to function in part through the regulation of intracellular Ca2+ mobilization.
Protein length: 357 amino acids
Molecular Weight: 65.340kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MDLPVNLTSFSLSTPSPLETNHSLGKDDLRPSSPLLSVFG VLILTLLGFLVAATFAWNLLVLATILRVRTFHRVPHNLVA SMAVSDVLVAALVMPLSLVHELSGRRWQLGRRLCQLWIAC DVLCCTASIWNVTAIALDRYWSITRHMEYTLRTRKCVSNV MIALTWALSAVISLAPLLFGWGETYSEGSEECQVSREPSY AVFSTVGAFYLPLCVVLFVYWKIYKAAKFRVGSRKTNSVS PISEAVEVKDSAKQPQMVFTVRHATVTFQPEGDTWREQKE QRAALMVGILIGVFVLCWIPFFLTELISPLCSCDIPAIWK SIFLWLGYSNSFFNPLIYTAFNKNYNSAFKNFFSRQH
Sequence Similarities: Belongs to the G-protein coupled receptor 1 family.
Gene Name: HTR5A 5-hydroxytryptamine (serotonin) receptor 5A [ Homo sapiens ]
Official Symbol: HTR5A
Synonyms: HTR5A; 5-hydroxytryptamine (serotonin) receptor 5A; 5-hydroxytryptamine receptor 5A; 5 HT5A;
Gene ID: 3361
mRNA Refseq: NM_024012
Protein Refseq: NP_076917
MIM: 601305
Uniprot ID: P47898
Chromosome Location: 7q36.1
Pathway: Amine ligand-binding receptors, organism-specific biosystem; Calcium signaling pathway, organism-specific biosystem; Calcium signaling pathway, conserved biosystem; Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; G alpha (i) signalling events, organism-specific biosystem;
Function: G-protein coupled receptor activity; receptor activity; serotonin receptor activity; signal transducer activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.