Recombinant Full Length Human HTR5A Protein, GST-tagged
Cat.No. : | HTR5A-5699HF |
Product Overview : | Human HTR5A full-length ORF ( NP_076917.1, 1 a.a. - 357 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 357 amino acids |
Description : | The neurotransmitter serotonin (5-hydroxytryptamine, 5-HT) has been implicated in a wide range of psychiatric conditions and also has vasoconstrictive and vasodilatory effects. The gene described in this record is a member of 5-hydroxytryptamine (serotonin) receptor family and encodes a multi-pass membrane protein that functions as a receptor for 5-hydroxytryptamine and couples to G-proteins. This protein has been shown to function in part through the regulation of intracellular Ca2+ mobilization. [provided by RefSeq |
Molecular Mass : | 66.7 kDa |
AA Sequence : | MDLPVNLTSFSLSTPSPLETNHSLGKDDLRPSSPLLSVFGVLILTLLGFLVAATFAWNLLVLATILRVRTFHRVPHNLVASMAVSDVLVAALVMPLSLVHELSGRRWQLGRRLCQLWIACDVLCCTASIWNVTAIALDRYWSITRHMEYTLRTRKCVSNVMIALTWALSAVISLAPLLFGWGETYSEGSEECQVSREPSYAVFSTVGAFYLPLCVVLFVYWKIYKAAKFRVGSRKTNSVSPISEAVEVKDSAKQPQMVFTVRHATVTFQPEGDTWREQKEQRAALMVGILIGVFVLCWIPFFLTELISPLCSCDIPAIWKSIFLWLGYSNSFFNPLIYTAFNKNYNSAFKNFFSRQH |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | HTR5A 5-hydroxytryptamine (serotonin) receptor 5A, G protein-coupled [ Homo sapiens ] |
Official Symbol | HTR5A |
Synonyms | HTR5A; 5-hydroxytryptamine (serotonin) receptor 5A, G protein-coupled; 5 hydroxytryptamine (serotonin) receptor 5A; 5-hydroxytryptamine receptor 5A; 5 HT5A; 5-HT-5; 5-HT-5A; serotonin receptor 5A; 5-HT5A; MGC138226; |
Gene ID | 3361 |
mRNA Refseq | NM_024012 |
Protein Refseq | NP_076917 |
MIM | 601305 |
UniProt ID | P47898 |
◆ Recombinant Proteins | ||
HTR5A-5235H | Recombinant Human HTR5A Protein, GST-tagged | +Inquiry |
HTR5A-242HF | Recombinant Full Length Human HTR5A Protein | +Inquiry |
HTR5A-2194H | Recombinant Human HTR5A Protein, MYC/DDK-tagged | +Inquiry |
HTR5A-2176R | Recombinant Rhesus monkey HTR5A Protein, His-tagged | +Inquiry |
HTR5A-26029TH | Recombinant Human HTR5A | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HTR5A Products
Required fields are marked with *
My Review for All HTR5A Products
Required fields are marked with *