"IDH3G" Related Products

Expand

Recombinant Human IDH3G

Cat.No.: IDH3G-28079TH
Product Overview: Recombinant full length Human IDH3G with N terminal proprietary tag; Predicted MWt 69.34 kDa.
Description: Isocitrate dehydrogenases catalyze the oxidative decarboxylation of isocitrate to 2-oxoglutarate. These enzymes belong to two distinct subclasses, one of which utilizes NAD(+) as the electron acceptor and the other NADP(+). Five isocitrate dehydrogenases have been reported: three NAD(+)-dependent isocitrate dehydrogenases, which localize to the mitochondrial matrix, and two NADP(+)-dependent isocitrate dehydrogenases, one of which is mitochondrial and the other predominantly cytosolic. NAD(+)-dependent isocitrate dehydrogenases catalyze the allosterically regulated rate-limiting step of the tricarboxylic acid cycle. Each isozyme is a heterotetramer that is composed of two alpha subunits, one beta subunit, and one gamma subunit. The protein encoded by this gene is the gamma subunit of one isozyme of NAD(+)-dependent isocitrate dehydrogenase. This gene is a candidate gene for periventricular heterotopia. Several alternatively spliced transcript variants of this gene have been described, but only some of their full length natures have been determined.
Protein length: 393 amino acids
Molecular Weight: 69.340kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MALKVATVAGSAAKAVLGPALLCRPWEVLGAHEVPSRNIF SEQTIPPSAKYGGRHTVTMIPGDGIGPELMLHVKSVFRHA CVPVDFEEVHVSSNADEEDIRNAIMAIRRNRVALKGNIET NHNLPPSHKSRNNILRTSLDLYANVIHCKSLPGVVTRHKD IDILIVRENTEGEYSSLEHESVAGVVESLKIITKAKSLRI AEYAFKLAQESGRKKVTAVHKANIMKLGDGLFLQCCREVA ARYPQITFENMIVDNTTMQLVSRPQQFDVMVMPNLYGNIV NNVCAGLVGGPGLVAGANYGHVYAVFETATRNTGKSIANK NIANPTATLLASCMMLDHLKLHSYAASIRKAVLASMDNEN MHTPDIGGQGTTSEAIQDVIRHIRVINGRAVEA
Sequence Similarities: Belongs to the isocitrate and isopropylmalate dehydrogenases family.
Gene Name: IDH3G isocitrate dehydrogenase 3 (NAD+) gamma [ Homo sapiens ]
Official Symbol: IDH3G
Synonyms: IDH3G; isocitrate dehydrogenase 3 (NAD+) gamma; isocitrate dehydrogenase [NAD] subunit gamma, mitochondrial;
Gene ID: 3421
mRNA Refseq: NM_004135
Protein Refseq: NP_004126
MIM: 300089
Uniprot ID: P51553
Chromosome Location: Xq28
Pathway: Citrate cycle (TCA cycle), organism-specific biosystem; Citrate cycle (TCA cycle), conserved biosystem; Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate, organism-specific biosystem; Citrate cycle, first carbon oxidation, oxaloacetate =>
Function: ATP binding; NAD binding; isocitrate dehydrogenase (NAD+) activity; magnesium ion binding; oxidoreductase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.