Recombinant Human IGF2R, His-tagged IGF2R-29238TH

Recombinant Human IGF2R, His-tagged

PRODUCTS

Home / Products / Recombinant Human IGF2R, His-tagged

Recombinant Human IGF2R, His-tagged

IGF2R Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : IGF2R-29238TH
Product Overview : Recombinant fragment, corresponding to amino acids 1510-1761 of Human Mannose 6 Phosphate Receptor with N terminal His tag; 252 amino acids, 29kDa.
Description : The protein encoded by this gene is a receptor for both, insulin-like growth factor 2 (IGF2) and mannose 6-phosphate (M6P). The IGF2 and M6P binding sites are located on different segments of the receptor. This receptor functions in the intracellular trafficking of lysosomal enzymes, the activation of transforming growth factor beta, and the degradation of IGF2. While the mouse Igf2r gene shows exclusive expression from the maternal allele, imprinting of the human IGF2R gene appears to be polymorphic, with only a minority of individuals showing expression from the maternal allele.
Conjugation : HIS
Source : E. coli
Form : Lyophilised:Reconstitute with 81 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : SNEHDDCQVTNPSTGHLFDLSSLSGRAGFTAAYSEKGLVY MSICGENENCPPGVGACFGQTRISVGKANKRLRYVDQV LQLVYKDGSPCPSKSGLSYKSVISFVCRPEAGPTNRPMLI SLDKQTCTLFFSWHTPLACEQATECSVRNGSSIVDLSP LIHRTGGYEAYDESEDDASDTNPDFYINICQPLNPMHG VPCPAGAAVCKVPIDGPPIDIGRVAGPPILNPIANEIYLN FESSTPCLADKHFNYTSL
Sequence Similarities : Belongs to the MRL1/IGF2R family.Contains 1 fibronectin type-II domain.
Gene Name : IGF2R insulin-like growth factor 2 receptor [ Homo sapiens ]
Official Symbol : IGF2R
Synonyms : IGF2R; insulin-like growth factor 2 receptor; cation-independent mannose-6-phosphate receptor; cation independent mannose 6 phosphate receptor; CD222; CIMPR; M6P R; MPR1; MPRI;
Gene ID : 3482
mRNA Refseq : NM_000876
Protein Refseq : NP_000867
MIM : 147280
Uniprot ID : P11717
Chromosome Location : 6q25-q27
Pathway : Clathrin derived vesicle budding, organism-specific biosystem; Golgi Associated Vesicle Biogenesis, organism-specific biosystem; Lysosome, organism-specific biosystem; Lysosome, conserved biosystem; Membrane Trafficking, organism-specific biosystem;
Function : glycoprotein binding; insulin-like growth factor binding; insulin-like growth factor-activated receptor activity; mannose binding; phosphoprotein binding;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy