Recombinant Human KLRC3
Cat.No. : | KLRC3-29905TH |
Product Overview : | Recombinant fragment of Human KLRC3 with a N terminal proprietary tag; Predicted MWt 37.62 kDa. |
- Specification
- Gene Information
- Related Products
Description : | Natural killer (NK) cells are lymphocytes that can mediate lysis of certain tumor cells and virus-infected cells without previous activation. They can also regulate specific humoral and cell-mediated immunity. NK cells preferentially express several calcium-dependent (C-type) lectins, which have been implicated in the regulation of NK cell function. KLRC3 is a member of the NKG2 group which are expressed primarily in natural killer (NK) cells and encodes a family of transmembrane proteins characterized by a type II membrane orientation (extracellular C terminus) and the presence of a C-type lectin domain. The NKG2 gene family is located within the NK complex, a region that contains several C-type lectin genes preferentially expressed on NK cells. Alternative splicing results in multiple transcript variants encoding different isoforms. |
Protein length : | 109 amino acids |
Molecular Weight : | 37.620kDa inclusive of tags |
Source : | Wheat germ |
Tissue specificity : | Natural killer cells. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | GKERRTWEESLQACASKNSSSLLSIDNEEEMKFLASILPS SWIGVFRNSSHHPWVTINGLAFKHEIKDSDHAERNCAMLH VRGLISDQCGSSRIIRRGFIMLTRLVLNS |
Sequence Similarities : | Contains 1 C-type lectin domain. |
Gene Name : | KLRC3 killer cell lectin-like receptor subfamily C, member 3 [ Homo sapiens ] |
Official Symbol : | KLRC3 |
Synonyms : | KLRC3; killer cell lectin-like receptor subfamily C, member 3; NKG2-E type II integral membrane protein; NKG2 E; |
Gene ID : | 3823 |
mRNA Refseq : | NM_002261 |
Protein Refseq : | NP_002252 |
MIM : | 602892 |
Uniprot ID : | Q07444 |
Chromosome Location : | 12p13 |
Pathway : | Antigen processing and presentation, organism-specific biosystem; Antigen processing and presentation, conserved biosystem; Natural killer cell mediated cytotoxicity, organism-specific biosystem; Natural killer cell mediated cytotoxicity, conserved biosystem; |
Function : | binding; receptor activity; sugar binding; transmembrane signaling receptor activity; |
Products Types
◆ Recombinant Protein | ||
KLRC3-4913H | Recombinant Human KLRC3 Protein, GST-tagged | +Inquiry |
KLRC3-2258R | Recombinant Rhesus Macaque KLRC3 Protein, His (Fc)-Avi-tagged | +Inquiry |
KLRC3-2437R | Recombinant Rhesus monkey KLRC3 Protein, His-tagged | +Inquiry |
KLRC3-7170H | Recombinant Human Killer Cell Lectin-Like Receptor Subfamily C, Member 3, His-tagged | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (0)
Ask a questionAsk a Question for All KLRC3 Products
Required fields are marked with *
My Review for All KLRC3 Products
Required fields are marked with *
0
Inquiry Basket