"LAT" Related Products

Expand

Recombinant Human LAT, His-tagged

Cat.No.: LAT-29047TH
Product Overview: Recombinant fragment of Human LAT isoform 2 protein with an N terminal His tag; 227 amino acids with the tag; predicted MWt: 24.4 kDa.
Description: The protein encoded by this gene is phosphorylated by ZAP-70/Syk protein tyrosine kinases following activation of the T-cell antigen receptor (TCR) signal transduction pathway. This transmembrane protein localizes to lipid rafts and acts as a docking site for SH2 domain-containing proteins. Upon phosphorylation, this protein recruits multiple adaptor proteins and downstream signaling molecules into multimolecular signaling complexes located near the site of TCR engagement. Alternative splicing results in multiple transcript variants encoding different isoforms.
Protein length: 206 amino acids
Conjugation: HIS
Molecular Weight: 24.400kDa inclusive of tags
Source: E. coli
Tissue specificity: Expressed in thymus, T-cells, NK cells, mast cells and, at lower levels, in spleen. Present in T-cells but not B-cells (at protein level).
Form: Liquid
Purity: >95% by SDS-PAGE
Storage buffer: pH: 8.00Constituents:0.32% Tris HCl, 0.02% DTT
Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMHCHRLPGSYDSTSSDSLYPRGIQFKRPHTVAPWPPAYPPVTSYPPLSQPDLLPIPRSPQPLGGSHRTPSSRRDSDGANSVASYENEEPACEDADEDEDDYHNPGYLVVLPDSTPATSTAAPSAPALSTPGIRDSAFSMESIDDYVNVPESGESAEASLDGSREYVNVSQELHPGAAKTEPAALSSQEAEEVEEEGAPDYENLQELN
Gene Name: LAT linker for activation of T cells [ Homo sapiens ]
Official Symbol: LAT
Synonyms: LAT; linker for activation of T cells; linker for activation of T-cells family member 1; LAT1; transmembrane adaptor;
Gene ID: 27040
mRNA Refseq: NM_001014987
Protein Refseq: NP_001014987
MIM: 602354
Uniprot ID: O43561
Chromosome Location: 16q13
Pathway: Adaptive Immune System, organism-specific biosystem; Fc epsilon RI signaling pathway, organism-specific biosystem; Fc epsilon RI signaling pathway, conserved biosystem; Fc gamma R-mediated phagocytosis, organism-specific biosystem; Fc gamma R-mediated phagocytosis, conserved biosystem;
Function: SH3/SH2 adaptor activity; protein binding; protein kinase binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.