Recombinant Human LAT, His-tagged

Cat.No. : LAT-29047TH
Product Overview : Recombinant fragment of Human LAT isoform 2 protein with an N terminal His tag; 227 amino acids with the tag; predicted MWt: 24.4 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 206 amino acids
Description : The protein encoded by this gene is phosphorylated by ZAP-70/Syk protein tyrosine kinases following activation of the T-cell antigen receptor (TCR) signal transduction pathway. This transmembrane protein localizes to lipid rafts and acts as a docking site for SH2 domain-containing proteins. Upon phosphorylation, this protein recruits multiple adaptor proteins and downstream signaling molecules into multimolecular signaling complexes located near the site of TCR engagement. Alternative splicing results in multiple transcript variants encoding different isoforms.
Conjugation : HIS
Molecular Weight : 24.400kDa inclusive of tags
Tissue specificity : Expressed in thymus, T-cells, NK cells, mast cells and, at lower levels, in spleen. Present in T-cells but not B-cells (at protein level).
Form : Liquid
Purity : >95% by SDS-PAGE
Storage buffer : pH: 8.00Constituents:0.32% Tris HCl, 0.02% DTT
Storage : Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMHCHRLPGSYDSTSSDSLYPRGIQFKRPHTVAPWPPAYPPVTSYPPLSQPDLLPIPRSPQPLGGSHRTPSSRRDSDGANSVASYENEEPACEDADEDEDDYHNPGYLVVLPDSTPATSTAAPSAPALSTPGIRDSAFSMESIDDYVNVPESGESAEASLDGSREYVNVSQELHPGAAKTEPAALSSQEAEEVEEEGAPDYENLQELN
Gene Name LAT linker for activation of T cells [ Homo sapiens ]
Official Symbol LAT
Synonyms LAT; linker for activation of T cells; linker for activation of T-cells family member 1; LAT1; transmembrane adaptor;
Gene ID 27040
mRNA Refseq NM_001014987
Protein Refseq NP_001014987
MIM 602354
Uniprot ID O43561
Chromosome Location 16q13
Pathway Adaptive Immune System, organism-specific biosystem; Fc epsilon RI signaling pathway, organism-specific biosystem; Fc epsilon RI signaling pathway, conserved biosystem; Fc gamma R-mediated phagocytosis, organism-specific biosystem; Fc gamma R-mediated phagocytosis, conserved biosystem;
Function SH3/SH2 adaptor activity; protein binding; protein kinase binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LAT Products

Required fields are marked with *

My Review for All LAT Products

Required fields are marked with *

0
cart-icon