Recombinant Human LAT, His-tagged
Cat.No. : | LAT-29047TH |
Product Overview : | Recombinant fragment of Human LAT isoform 2 protein with an N terminal His tag; 227 amino acids with the tag; predicted MWt: 24.4 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 206 amino acids |
Description : | The protein encoded by this gene is phosphorylated by ZAP-70/Syk protein tyrosine kinases following activation of the T-cell antigen receptor (TCR) signal transduction pathway. This transmembrane protein localizes to lipid rafts and acts as a docking site for SH2 domain-containing proteins. Upon phosphorylation, this protein recruits multiple adaptor proteins and downstream signaling molecules into multimolecular signaling complexes located near the site of TCR engagement. Alternative splicing results in multiple transcript variants encoding different isoforms. |
Conjugation : | HIS |
Molecular Weight : | 24.400kDa inclusive of tags |
Tissue specificity : | Expressed in thymus, T-cells, NK cells, mast cells and, at lower levels, in spleen. Present in T-cells but not B-cells (at protein level). |
Form : | Liquid |
Purity : | >95% by SDS-PAGE |
Storage buffer : | pH: 8.00Constituents:0.32% Tris HCl, 0.02% DTT |
Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMHCHRLPGSYDSTSSDSLYPRGIQFKRPHTVAPWPPAYPPVTSYPPLSQPDLLPIPRSPQPLGGSHRTPSSRRDSDGANSVASYENEEPACEDADEDEDDYHNPGYLVVLPDSTPATSTAAPSAPALSTPGIRDSAFSMESIDDYVNVPESGESAEASLDGSREYVNVSQELHPGAAKTEPAALSSQEAEEVEEEGAPDYENLQELN |
Gene Name | LAT linker for activation of T cells [ Homo sapiens ] |
Official Symbol | LAT |
Synonyms | LAT; linker for activation of T cells; linker for activation of T-cells family member 1; LAT1; transmembrane adaptor; |
Gene ID | 27040 |
mRNA Refseq | NM_001014987 |
Protein Refseq | NP_001014987 |
MIM | 602354 |
Uniprot ID | O43561 |
Chromosome Location | 16q13 |
Pathway | Adaptive Immune System, organism-specific biosystem; Fc epsilon RI signaling pathway, organism-specific biosystem; Fc epsilon RI signaling pathway, conserved biosystem; Fc gamma R-mediated phagocytosis, organism-specific biosystem; Fc gamma R-mediated phagocytosis, conserved biosystem; |
Function | SH3/SH2 adaptor activity; protein binding; protein kinase binding; |
◆ Recombinant Proteins | ||
LAT-29047TH | Recombinant Human LAT, His-tagged | +Inquiry |
LAT-001H | Recombinant Human LAT Protein, His-tagged | +Inquiry |
LAT-3359R | Recombinant Rat LAT Protein | +Inquiry |
LAT-335H | Recombinant Human LAT Protein, His-tagged | +Inquiry |
RFL20533MF | Recombinant Full Length Mouse Linker For Activation Of T-Cells Family Member 1(Lat) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LAT-4817HCL | Recombinant Human LAT 293 Cell Lysate | +Inquiry |
LAT-4816HCL | Recombinant Human LAT 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LAT Products
Required fields are marked with *
My Review for All LAT Products
Required fields are marked with *