"LEP" Related Products

Expand
Expand
Expand

Native Human LEP

Cat.No.: LEP-27641TH
Product Overview: Human Leptin
Description: This gene encodes a protein that is secreted by white adipocytes, and which plays a major role in the regulation of body weight. This protein, which acts through the leptin receptor, functions as part of a signaling pathway that can inhibit food intake and/or regulate energy expenditure to maintain constancy of the adipose mass. This protein also has several endocrine functions, and is involved in the regulation of immune and inflammatory responses, hematopoiesis, angiogenesis and wound healing. Mutations in this gene and/or its regulatory regions cause severe obesity, and morbid obesity with hypogonadism. This gene has also been linked to type 2 diabetes mellitus development.
Source: E. coli
Form: Lyophilised:Reconstitute in water to a concentration of 1.0-5.0 mg/ml.
Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids: Human Leptin is a 16 kDa protein containing 147 amino acid residues:MVPIQKVQDDTKTLIKTIVTRINDISHTQSVSSKQKVTGLDFIPGL HPILTLSKMDQTLAVYQQILTSMPSRNVIQISNDLEN LRDLLHVLAFSKSCHLPWASGLETLDSLGGVLEASGY STEVVALSRLQGSLQDMLWQLDLSPGC
Sequence Similarities: Belongs to the leptin family.
Gene Name: LEP leptin [ Homo sapiens ]
Official Symbol: LEP
Synonyms: LEP; leptin; leptin (murine obesity homolog) , leptin (obesity homolog, mouse) , OB, OBS;
Gene ID: 3952
mRNA Refseq: NM_000230
Protein Refseq: NP_000221
Uniprot ID: P41159
Chromosome Location: 7q31
Pathway: Adipocytokine signaling pathway, organism-specific biosystem; Adipocytokine signaling pathway, conserved biosystem; Adipogenesis, organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem;
Function: growth factor activity; hormone activity; peptide hormone receptor binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.