"LIN28A" Related Products

Expand
Expand

Recombinant Human LIN28A

Cat.No.: LIN28A-29947TH
Product Overview: Recombinant fragment corresponding to amino acids 3-182 of Human Lin28 fused to a 13 residue C-terminal TAT peptide; 222 amino acids, MWt 24.4 kDa.
Protein length: 180 amino acids
Molecular Weight: 24.400kDa inclusive of tags
Source: E. coli
Tissue specificity: Expressed in embryonic stem cells (ES cells), placenta and testis.
Biological activity: Measured by its ability to induce fluorescence in Lin28 reporter cells (293 cells transfected with fluorescent protein genes under Lin28 control). Optimum activity was achieved at 20 μg/ml after incubation for 72 hr.
Form: Lyophilised:Reconstitute in water to a concentration of 1.0 mg/ml
Purity: >90% by SDS-PAGE
Storage buffer: Preservative: NoneConstituents: 10mM Sodium citrate, pH 3.0
Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids: GPSVSNQQFAGGCAKAAEEAPEEAPEDAARAADEPQLLHGAGICKWFNVRMGFGFLSMTARAGVALDPPVDVFVHQSKLHMEGFRSLKEGEAVEFTFKKSAKGLESIRVTGPGGVFCIGSERRPKGKSMQKRRSKGDRCYNCGGLDHHAKECKLPPQPKKCHFCQSISHMVASCPLKAQQGP
Sequence Similarities: Belongs to the lin-28 family.Contains 2 CCHC-type zinc fingers.Contains 1 CSD (cold-shock) domain.
Gene Name: LIN28A lin-28 homolog A (C. elegans) [ Homo sapiens ]
Official Symbol: LIN28A
Synonyms: LIN28A; lin-28 homolog A (C. elegans); lin 28 homolog (C. elegans) , LIN28; protein lin-28 homolog A; CSDD1; FLJ12457; LIN 28; ZCCHC1;
Gene ID: 79727
mRNA Refseq: NM_024674
Protein Refseq: NP_078950
MIM: 611043
Uniprot ID: Q9H9Z2
Chromosome Location: 1p35.3
Function: DNA binding; RNA binding; mRNA binding; metal ion binding; miRNA binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.