Recombinant Human LIN28A protein(1-209aa), His-SUMO-tagged

Cat.No. : LIN28A-3938H
Product Overview : Recombinant Human LIN28A protein(Q9H9Z2)(1-209aa), fused with N-terminal His and SUMO tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&SUMO
Protein Length : 1-209aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 35.7 kDa
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
AA Sequence : MGSVSNQQFAGGCAKAAEEAPEEAPEDAARAADEPQLLHGAGICKWFNVRMGFGFLSMTARAGVALDPPVDVFVHQSKLHMEGFRSLKEGEAVEFTFKKSAKGLESIRVTGPGGVFCIGSERRPKGKSMQKRRSKGDRCYNCGGLDHHAKECKLPPQPKKCHFCQSISHMVASCPLKAQQGPSAQGKPTYFREEEEEIHSPTLLPEAQN
Gene Name LIN28A lin-28 homolog A (C. elegans) [ Homo sapiens ]
Official Symbol LIN28A
Synonyms LIN28A; lin-28 homolog A (C. elegans); lin 28 homolog (C. elegans) , LIN28; protein lin-28 homolog A; CSDD1; FLJ12457; LIN 28; ZCCHC1; RNA-binding protein LIN-28; zinc finger, CCHC domain containing 1; zinc finger CCHC domain-containing protein 1; LIN28; LIN-28; lin-28A;
Gene ID 79727
mRNA Refseq NM_024674
Protein Refseq NP_078950
MIM 611043
UniProt ID Q9H9Z2

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LIN28A Products

Required fields are marked with *

My Review for All LIN28A Products

Required fields are marked with *

0
cart-icon
0
compare icon