Recombinant Human LIN28A protein(1-209aa), His-SUMO-tagged
Cat.No. : | LIN28A-3938H |
Product Overview : | Recombinant Human LIN28A protein(Q9H9Z2)(1-209aa), fused with N-terminal His and SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-209aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 35.7 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | MGSVSNQQFAGGCAKAAEEAPEEAPEDAARAADEPQLLHGAGICKWFNVRMGFGFLSMTARAGVALDPPVDVFVHQSKLHMEGFRSLKEGEAVEFTFKKSAKGLESIRVTGPGGVFCIGSERRPKGKSMQKRRSKGDRCYNCGGLDHHAKECKLPPQPKKCHFCQSISHMVASCPLKAQQGPSAQGKPTYFREEEEEIHSPTLLPEAQN |
Gene Name | LIN28A lin-28 homolog A (C. elegans) [ Homo sapiens ] |
Official Symbol | LIN28A |
Synonyms | LIN28A; lin-28 homolog A (C. elegans); lin 28 homolog (C. elegans) , LIN28; protein lin-28 homolog A; CSDD1; FLJ12457; LIN 28; ZCCHC1; RNA-binding protein LIN-28; zinc finger, CCHC domain containing 1; zinc finger CCHC domain-containing protein 1; LIN28; LIN-28; lin-28A; |
Gene ID | 79727 |
mRNA Refseq | NM_024674 |
Protein Refseq | NP_078950 |
MIM | 611043 |
UniProt ID | Q9H9Z2 |
◆ Recombinant Proteins | ||
LIN28A-1577H | Recombinant Full Length Human LIN28A Protein, Tag Free | +Inquiry |
LIN28A-1432H | Recombinant Human LIN28A protein, His-tagged | +Inquiry |
LIN28A-3677H | Recombinant Human LIN28A Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
LIN28A-5089M | Recombinant Mouse LIN28A Protein, His (Fc)-Avi-tagged | +Inquiry |
LIN28A-01HFL | Recombinant Full Length Human LIN28A Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
LIN28A-4734HCL | Recombinant Human LIN28A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LIN28A Products
Required fields are marked with *
My Review for All LIN28A Products
Required fields are marked with *
0
Inquiry Basket