"MCM3" Related Products

Expand
Expand
Expand

Recombinant Human MCM3, His-tagged

Cat.No.: MCM3-28038TH
Product Overview: Recombinant fragment, corresponding to amino acids 182-808 of Human MCM3 with an N-terminal His tag; Predicted MWt 71kDa.
Description: The protein encoded by this gene is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are involved in the initiation of eukaryotic genome replication. The hexameric protein complex formed by MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. This protein is a subunit of the protein complex that consists of MCM2-7. It has been shown to interact directly with MCM5/CDC46. This protein also interacts with, and thus is acetlyated by MCM3AP, a chromatin-associated acetyltransferase. The acetylation of this protein inhibits the initiation of DNA replication and cell cycle progression.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:Reconstitute with 84 μl aqua dest
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: NPLETEYGLSVYKDHQTITIQEMPEKAPAGQLPRSVDVIL DDDLVDKAKPGDRVQVVGTYRCLPGKKGGYTSGTFRTV LIACNVKQMSKDAQPSFSAEDIAKIKKFSKTRSKDIFD QLAKSLAPSIHGHDYVKKAILCLLLGGVERDLENGSHI RGDINILLIGDPSVAKSQLLRYVLCTAPRAIPTTGRGSSG VGLTAAVTTDQETGERRLEAGAMVLADRGVVCIDEFDK MSDMDRTAIHEVMEQGRVTIAKAGIHARLNARCSVLAA ANPVYGRYDQYKTPMENIGLQDSLLSRFDLLFIMLDQM DPEQDREISDHVLRMHRYRAPGEQDGDAMPLGSAVDILAT DDPNFSQEDQQDTQIYEKHDNLLHGTKKKKEKMVSAAF MKKYIHVAKIIKPVLTQESATYIAEEYSRLRSQDSMSS DTARTSPVTARTLETLIRLATAHAKARMSKTVDLQDAE EAVELVQYAYFKKVLEKEKKRKKRSEDESETEDEEEKSQEDQEQKRKRRKTRQPDAKDGDSYDPYDFSDTEEEMPQVH TPKTADSQETKESQKVELSESRLKAFKVALLDVFREAH AQSIGMNRLTESINRDSEEPFSSVEIQAALSKMQDDNQ VMVSEGIIFLI
Sequence Similarities: Belongs to the MCM family.Contains 1 MCM domain.
Gene Name: MCM3 minichromosome maintenance complex component 3 [ Homo sapiens ]
Official Symbol: MCM3
Synonyms: MCM3; minichromosome maintenance complex component 3; MCM3 minichromosome maintenance deficient 3 (S. cerevisiae) , minichromosome maintenance deficient (S. cerevisiae) 3; DNA replication licensing factor MCM3;
Gene ID: 4172
mRNA Refseq: NM_002388
Protein Refseq: NP_002379
MIM: 602693
Uniprot ID: P25205
Chromosome Location: 6p12
Pathway: Activation of ATR in response to replication stress, organism-specific biosystem; Activation of the pre-replicative complex, organism-specific biosystem; Assembly of the pre-replicative complex, organism-specific biosystem; Cell Cycle Checkpoints, organism-specific biosystem; Cell Cycle, Mitotic, organism-specific biosystem;
Function: ATP binding; DNA binding; helicase activity; hydrolase activity; nucleotide binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.